SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397671145|ref|YP_006512680.1| from Propionibacterium propionicum F0230a

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|397671145|ref|YP_006512680.1|
Domain Number - Region: 8-65
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.0379
Family F1F0 ATP synthase subunit C 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397671145|ref|YP_006512680.1|
Sequence length 121
Comment hypothetical protein HMPREF9154_2505 [Propionibacterium propionicum F0230a]
Sequence
MKSKTFPLVGWSLVIIGILHNLLGFFAGWQVLLDAADAGLIGVWDAPPTRGRIFWFLVTG
FALIAIGLLAAQLERSGVAIPWSFIVFFGLLTLTGVVLMPASGFWLLLFPVAVCLIRRLR
R
Download sequence
Identical sequences I6XNS6
WP_014847464.1.90705 WP_014847464.1.99876 gi|397671145|ref|YP_006512680.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]