SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PKH_041740 from Plasmodium knowlesi strain H

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PKH_041740
Domain Number 1 Region: 213-373
Classification Level Classification E-value
Superfamily Gametocyte protein Pfg27 8.63e-35
Family Gametocyte protein Pfg27 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PKH_041740
Sequence length 400
Comment PKH_041740 hypothetical protein, conserved in Plasmodium species 3298326:3299528 reverse MW:47171
Sequence
MLDNSESSLKRLNFLLQFFHFLVFYYFFFYNFCTLFCFPLNRVKMFKKCLVVISLNLLLK
VTFNSSPFFAHALGIRTDRESSNVWEEYISVNYEPLEQDLSEACDYIALEEYSACGNISN
EKSNNENDVEVEGSNIIVKNEERGTQTEEEEDEKVEGIYDEVTHQDDEKGSDDQGSNNEL
AGEYRIEEVDENVAILNENINSIHEMQSPLDSYKTIFLILSTEFDTTETYLNKIMNCSTD
EEKNELLDDHIGILKEMYENCKKNENFRLPFEIRDSMALRISDRLRDFCFSDYVTESNMV
ALKSIFSIELEVFEGIFYYIEHKNTYREKKEVINDLELIKFYHEELITNNGLYLTDEQFD
NAAMRVSNFVNDLYFLCFSNYQNMIKFREMQDAMSTYITL
Download sequence
Identical sequences A0A1A7VNM2 A0A1Y3DVT3 B3L0X7
PKH_041740 XP_002258009.1.91479 gi|193807841|emb|CAQ38546.1| gi|221053269|ref|XP_002258009.1| 5850.PKH_041740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]