SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PKH_041310 from Plasmodium knowlesi strain H

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PKH_041310
Domain Number 1 Region: 312-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000138
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PKH_041310
Sequence length 374
Comment PKH_041310 merozoite surface protein 5 3118290:3119662 forward MW:41642
Sequence
MAMARVALAIHLFFLCSYQSGHPLKFSFWREEKIHLQIYTNRLLREEGKNDNVEQMESPS
ISGTEGKKEIQMISHLQLQSGKHDQVSFLSANDSNLKGANEEASAESGENGKKSDEENVK
KSDEENAKKSDEENKDANSNTKDAESAEGEENPVSQENQMKTLNNEEDKTNDGKKNGDEE
DKKGEKGKDDGKGEEGSEEKMEESAKKEEENTEANKNLESKHAEAEVSEHKQDVTTPEGG
KDSPEGENQKENTPNNTNQENQENADNDENKLHLDKLDDDVPHYSALRNNRVDKGITDSM
MLKNIIEDNTKSCSVNNGGCADDQICIRINNMGIKCICKEGHLFGGKCILSRSSAINTFF
SVGLSVLLAFLWMC
Download sequence
Identical sequences A0A1A7VNH1 A0A1Y3DVP9 B3L0T4
PKH_041310 5850.PKH_041310 XP_002257966.1.91479 gi|193807798|emb|CAQ38503.1| gi|221053183|ref|XP_002257966.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]