SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PKH_070470 from Plasmodium knowlesi strain H

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PKH_070470
Domain Number - Region: 62-110
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.000589
Family NusA extra C-terminal domains 0.04
Further Details:      
 
Domain Number - Region: 10-40
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0162
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PKH_070470
Sequence length 192
Comment PKH_070470 hypothetical protein, conserved in Apicomplexan species 5955172:5956404 reverse MW:22702
Sequence
MMPENCSRKSVSKLFDCLSREIEKQQPKNVIHFMVDFLCKNYGSHLRGFAHVWDVDLELE
KEKKLVIEFFKSQKLTTEIAKHFINVGFDSMESLLYLNAHILDDIEKFNKVNWLPGHKIR
LQQMFSNIQENIKTFYAEYDKDDIKCGLDYSALRVSPGMRKKRKEKKKKKKEKKAVRASR
HQRGQLQLCVCT
Download sequence
Identical sequences B3L385
PKH_070470 gi|193808415|emb|CAQ39118.1| gi|221054414|ref|XP_002258346.1| XP_002258346.1.91479 5850.PKH_070470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]