SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PCAS_120620 from Plasmodium chabaudi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PCAS_120620
Domain Number 1 Region: 527-585
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000264
Family RING finger domain, C3HC4 0.0064
Further Details:      
 
Domain Number 2 Region: 355-451
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 0.00000000000000458
Family Cdc48 domain 2-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PCAS_120620
Sequence length 587
Comment PCAS_120620 conserved Plasmodium protein, unknown function 11787648:11789507 forward MW:68623
Sequence
MERKSGKSKYMHFLPIINSQAKLNILEKNNVLEKVHILPIKKRSSNYHELYNKLNKLINE
KNVLYEGVVISLKDGSESSDLKISKIPNINEKEENIKIKKTIDNDDVFGIDKVSTDESSA
DESKTCNMLLPLSDDEKNKSINKADSDILKNDQRENMSQLLDNNVDYVIINCIPSKGVLN
HDTLIYTDGKYVDYLKKIEIIIINDKNYKKYEKTIKRKFISFKKMVLKKSNEFFNGAMSL
FPLYFNFIPELCMSKSRNKVSKNEESSIEKITNHSTINEYNTKKKATKKINKIVIQNFLM
NHLIPYFKNNRNKLFYPGKLFNVNNFSFLVSKIDIDISAGFIDDLTEINLRVDSYEEYNN
VHIVPLYDTLPTTYNYNLFIDYIKPYIERHYLDTFSLYDTFFYRGVQFKIMGVDPIDMKC
GKGRISANTSIYTQGSVKPTFFDVISTKSFNYIKSLPFEYKPYAILNILQHLDTDSLLRL
FPSANINMESSTKDEQTILDHLTPLMYVYNKEKTSYDTKRILIGKNNMHTESNNNIINEQ
CAVCFDNFINEDKCIKLTCLHTYHWKCVKNWFRFNLTCPCCRHKLPI
Download sequence
Identical sequences A0A077TP00
PCAS_120620 XP_016654172.1.12432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]