SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386744120|ref|YP_006217299.1| from Providencia stuartii MRSN 2154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386744120|ref|YP_006217299.1|
Domain Number 1 Region: 2-45
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000122
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386744120|ref|YP_006217299.1|
Sequence length 56
Comment hypothetical protein S70_13880 [Providencia stuartii MRSN 2154]
Sequence
MLHHSILSTPPSLPTDCPHCHSDKDIILWGTGWMCRDCGHDWHIPSQEQTQAFQQA
Download sequence
Identical sequences A0A140NPN5 B2PXP3
gi|386744120|ref|YP_006217299.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]