SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386745176|ref|YP_006218355.1| from Providencia stuartii MRSN 2154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386745176|ref|YP_006218355.1|
Domain Number 1 Region: 148-332
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0000000000294
Family BCR-homology GTPase activation domain (BH-domain) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386745176|ref|YP_006218355.1|
Sequence length 338
Comment hypothetical protein S70_19340 [Providencia stuartii MRSN 2154]
Sequence
MKSTLSTSTPDFTSTTKIADTPLKPINQPKTSLFAASIQRVTNVLKKFLGLPSQHQHESI
EIKNKNIDVLNYKKLSDSDQENALPPSQYKTPAELNAMQMRIAQQQTAKLIEKQNIDAIN
EYIGIAYEDRLKYQQINEIGTAILSHPNYLHETGPFRISGNKQRVEIILEHLASNKSIDI
FFIQKNNIDVSDLTSAYKKLVGNVLDSSSSEQKTLSTLFTKYHDAIGNKATVKRAIETNP
TLATNKNNILAVSDTKILDSLPPLKKLPLILQIAVPLLTEISRHAEKHQMTPENLSIAFA
PTLDRTDYSKTAGNPLDQLKQIGLAQLPINYFTALLQR
Download sequence
Identical sequences A0A140ST35
WP_014658199.1.40371 gi|386745176|ref|YP_006218355.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]