SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000043 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000043
Domain Number 1 Region: 200-410
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.87e-53
Family Reprolysin-like 0.0013
Further Details:      
 
Domain Number 2 Region: 505-561
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000497
Family TSP-1 type 1 repeat 0.00045
Further Details:      
 
Domain Number 3 Region: 816-871
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000107
Family TSP-1 type 1 repeat 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000043   Gene: ENSGACG00000000029   Transcript: ENSGACT00000000043
Sequence length 873
Comment pep:novel scaffold:BROADS1:scaffold_204:21661:31577:-1 gene:ENSGACG00000000029 transcript:ENSGACT00000000043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPRAVWGAPRGPDTHRQPSEDVVPVRMNHRTSGRFWKRSEERPSFPLCAFDKELSLSLIP
DTGFIAPYFTGQRVLRGAPGARPAADLRTEEGEGRLRGCFYSGTVDDDQSSVVAVCAPGV
LGSFVTEGNEYFIEPKLRGVPGPDSAEQLHVVRRRTFARSLGVPLPWDQEAAADEKPKGG
SFTRGHGDARRAPRRRRFISAPRFIETLVVVDSTMAHFYGDEVKHYILTLMSMAAQLYKH
PSIKNSVSVVLVKMLVVEDEEVGPELSSNGGVALRNFCSWQQLFNPTSQRHPEHYDTAVL
FTREDICGQKSCDTLGVADVGTMCDPKRSCLVIEDNGLQAAFTAAHELGHVLSMPHDDSK
TCERLFGDLGGHFLMAPLFVSLNKSAPWSPCSALYVTEFFDNGHGDCLLDVPEAAMPLPG
EPPGARYGLDQQCQQMFGEDFVQCPNSSDSDACSQLWCQEDGTPQCSTRNGSLPWADGTP
CGLNGTCLRGACLATREASELPQVAVDGGWSSWGPWQRCSRTCGGGVEFSDRECADPVPL
NGGRYCEGQRLQYQSCNTHPCGDNDGKSFREEQCEKYHSPSYLDFSGNVKQWIPKYAGVS
PRDRCKLFCRARGSSEFKVFESKVIDGTTCGPDTTSVCVQGQCVKAGCDQVIGSNKRVDK
CGVCGGSGLTCRKITGSYNKATFGYSDIVTIPVGATNIDIKQRSHGGIKHDGNYLAIKRE
SGGYILNGNFSVSTVEQDIPVLGAVLKYSGSSTTLERIQSFRGLREVLTIQLLATAGDAN
PPKVKYTFFIPRDATFNRSKERKSSSPSPHAVHPLGVAGWQLGEWSECSKSCGSGWSRRS
VECRDGAGFPSDHCDRDLKPGDIRPCGDLPCPM
Download sequence
Identical sequences G3N426
ENSGACP00000000043 ENSGACP00000000043 69293.ENSGACP00000000043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]