SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000045 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000045
Domain Number 1 Region: 141-351
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.54e-54
Family Reprolysin-like 0.0014
Further Details:      
 
Domain Number 2 Region: 440-492
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000103
Family TSP-1 type 1 repeat 0.00068
Further Details:      
 
Domain Number 3 Region: 816-876
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000772
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 
Domain Number 4 Region: 767-817
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000314
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000045   Gene: ENSGACG00000000032   Transcript: ENSGACT00000000045
Sequence length 876
Comment pep:novel scaffold:BROADS1:scaffold_204:32607:41910:1 gene:ENSGACG00000000032 transcript:ENSGACT00000000045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FRFSAFERVLHLRLAPDSSFLALPGAADLRECFFSGTVNADPDSFAALSLCEGLRGFSYD
GMEYFIRPTDTADAEHRNSFNRTHVIHRWTRAAHSGANHTSRCAVTPDANFNGSFENREH
LDGLAATVVKNLGRSKRFASIPRFVEVLVVADESMAAFHGGDLKHYLMTLMAVAARLYKH
PSILNSINVVVVDFMVINEADKGPKISSNAALTLRNFCSWQKKLNKHNDKHPEYWDTAIL
FTKQDLCGATTCDTLGMADVGTMCDPKRSCSVIEDDGLPSAFTAAHELGHVFNMPHDNVK
ACEEVFGKLKDNHMMSPTLIQIDRSRPWSACSAAIITQFLDRGHGDCLLDQPQKQLSFSD
HMPGSSYSLHRQCELAFGPGSKPCPYMQPCTKLWCTGKARGQLVCQTRHFPWADGTSCGH
GKVCYRGACTDKNNTVHVKVDGRWGKWGAFGSCSRSCGGGVQLASRQCDNPVPQNGGRYC
YGLRIKYCSCNLNTCPKKAPGKSFREEQCEAFNGLSLNTNRLGSTVAWVPKYSGISPKDK
CKLICRANGTGYFYVLAPKVVDGTLCSPDTSAVCVQGKCIKAGCDGKLDSSRKFDKCGVC
GGDNQGCKKVSGMFTKPVHGYNFVATLPVGASNIDVRQRGYRGMVSDENYLAVKNRHGKY
LLNGNYVVSAVERDLLVKGALLRYSGTSSAVEILQSTRPLQEALTVEVLSVGKMTPPRVR
YSFYIAKDSKEDKTLRKEDKSHAAHNSVLADSNQVEAEELMASKRPVSHWVTGSWDPCTV
TCGSGLQKRPVHCQSTEGRPAADCSAADRPASARACGDPCPAWDAGGWSQCSKSCGRGFK
RRPVRCMTENGPSLPRDHCSGRRKPQELDLCNLKPC
Download sequence
Identical sequences G3N428
ENSGACP00000000045 69293.ENSGACP00000000045 ENSGACP00000000045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]