SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000088 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000088
Domain Number 1 Region: 129-185
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000432
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 2 Region: 1214-1271
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000837
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 559-623
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000034
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 
Domain Number 4 Region: 963-1022
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000288
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 5 Region: 702-755
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000419
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 6 Region: 292-344
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000107
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 7 Region: 626-697
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000575
Family TSP-1 type 1 repeat 0.0099
Further Details:      
 
Domain Number 8 Region: 833-887
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000235
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Domain Number 9 Region: 1097-1145
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000034
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 10 Region: 1341-1405
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000706
Family TSP-1 type 1 repeat 0.0064
Further Details:      
 
Domain Number 11 Region: 1269-1320
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000863
Family TSP-1 type 1 repeat 0.0082
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000000088
Domain Number - Region: 353-408
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000288
Family TSP-1 type 1 repeat 0.0076
Further Details:      
 
Domain Number - Region: 1148-1209
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000811
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number - Region: 1021-1080
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00288
Family TSP-1 type 1 repeat 0.0054
Further Details:      
 
Domain Number - Region: 762-832
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00497
Family TSP-1 type 1 repeat 0.0092
Further Details:      
 
Domain Number - Region: 443-498
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00602
Family TSP-1 type 1 repeat 0.0079
Further Details:      
 
Domain Number - Region: 57-127
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0392
Family TSP-1 type 1 repeat 0.014
Further Details:      
 
Domain Number - Region: 898-962
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0589
Family TSP-1 type 1 repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000088   Gene: ENSGACG00000000067   Transcript: ENSGACT00000000088
Sequence length 1590
Comment pep:novel scaffold:BROADS1:scaffold_58:73156:133895:1 gene:ENSGACG00000000067 transcript:ENSGACT00000000088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPWGRCMGSDCGPGGSQSRAVWCAHSEGWTTLHTNCNQTERPNNQQSCFRVCDWHKDLYD
WQLGAWNQCVPVSMRSAGVQRPALCRRGEEGIQTREVGCVQKADGEPAEDAICEYFEPKP
RLEQACLIPCPLDCVVSEFSLWTHCSKTCGMGLQNRIRFVLAPPLFGGAACPNLTEFQTC
QPEPCEEEGPPLQPQSGDPGDSCSVSNAQASPDRLIHHPETVTEHLRETKLSKEGGQTVQ
RQHENFKQDCTLWIQTRLVSPLSTTTNNSNINILCSQESLPVTFQACVMTKDCDVTEWSE
WSTCSKECYNPNGPNGERTRTRKVSQFPIDGGADCPELEEKEPCSPQRDGMPPCIVYSWR
TTEWTECRVDLLLSQQDRRRGNQTGLCGGGIQTREVYCVQTNMETPPNLGSLRSKEALRP
MDSDLCLGIPLNTTQLCHISCPVECEVSSWSAWGPCTYENCQDQAAKKGSFKMRKRKITN
EPTGGTGNCPHLMEAIPCEDPSCYEWLVAKLEECVPDNELCGPGTQMPQVQCVNSDGEYV
ERQLCRDAILPMPAICDVPCPKDCTLSPWAPWSLCSHTCSGKNTEGKQTRARSILAYNAG
EGGIQCPNNSALQEARNCNDHPCTVYHWQTGPWGQCIEDTSIPASNTSASRIRSDDASCS
VGMQTRKVICVRVNVGQVPPKKCPESLRPDTVRPCLLPCKRDCIVTPYSDWSLCPATCQA
GSSGSKKQYRKRIIIQIPANGGQDCPEVLTQERECDAPSVCQGYRWKTHKWRRCQLVPWS
VRQDSPGAQVTCGPGLQVRAISCRKQDGGLSDVEACLKLASSMPPLTQPCQLPCQEDCQL
SSWSKFSSCTADCVGVRTRKRMLIGKSKKRDQCKNNQMYPQSETQYCPCNKYNAQPVGNW
SDCVLPEGGRMEGQLGMKVQGDIKECGQGYRYQTMVCYDQDNRIVETSRCNSHGYIEEAC
IIPCPSDCKLSEWSNWSRCSKSCGSGVKVRSKWLREKPYNGGRPCPKLDHVNQAQVYEVV
PCLSDCGQYVWVAEPWSVWKVSNVDLKDNCGEGVQTRKVRCMLNSIDGPSELVEDYLCDP
EEIPLGARNGQLPCPEECVLSDWGAWNPCPLPCSGNSSRERSAFPLRQSGEGKECPSTQE
TQVCKLNSNCFHYSYNITDWSTCQLSERAVCGNGIKTRMLDCVRSDSKSVDLKFCEELGL
DRRWQMNSLCVVECPVNCQLSDWSTWSECTHTCGLAGKLWRRRTVIQAPQGDGRPCPSQL
EQWKPCLVKPCYSWRYSAWSECKSEGAKCGEGQRYRNVSCFVSDGSGQQESSLVDDELCG
DLEPSVDGDTHIVLQEPCTVPCPGECYLTDWTVWSPCQLSCVSGDDLGFGSVQVRSRAVV
AQDPENLLQCPEQELEARPCTEGQCFEYKWKTGPWRGSSRQVWCQRSDGLNVTGGCPVIS
KPMADRSCDPPCTKPRSLCTEAGVCGCEEGYTEIMTSDGLLDQCTVIPVLEIPTAGDNRA
DVKTIRAFNPTQPAASSPGRAGRTWFLQPFGPDGKLKTWVYGVAAGAFVLLVFIISMTYL
ACKKPKKPQRRQMNNRLKPLTLAYDGDADM
Download sequence
Identical sequences G3N470
69293.ENSGACP00000000088 ENSGACP00000000088 ENSGACP00000000088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]