SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000110 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000110
Domain Number 1 Region: 169-304,334-348
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000275
Family Growth factor receptor domain 0.0039
Further Details:      
 
Domain Number 2 Region: 305-345
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000107
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000110   Gene: ENSGACG00000000090   Transcript: ENSGACT00000000110
Sequence length 427
Comment pep:novel scaffold:BROADS1:scaffold_99:366155:369149:1 gene:ENSGACG00000000090 transcript:ENSGACT00000000110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLRSGQYIYPVLLCIVQILSICPHLCSITASHPELSVVRVQTAPCQTCRKLTESFIKGL
ERTATKNFGGGNTAWEEEKLAKYASSETRLLEIVEAACEKADFECNQLLEQIEDQVETWW
FHRQQEAPDLFEWLCIQELRVCCLPGRFGPDCKECPSSPGGVCGGLGRCEGEGTRLGDGE
CVCDPGYSGHLCQSCADGYFRERSSNSSRAACAACFHSCKKCAGPQDYKCLDCKPGWILH
DNKCVDVDECGTELARCPSNTFCHNTEGSYECRGCDQACVGCMGTGPARCKKCARGYKLR
GAKCLGTDVDECGDQAIACPGLNEACINEEGSFHCDCADGFIRRDSICVENKPPAGPEKG
LFDDMTDDEVLVLQQMFFGIVICAIATLAAKGDMVFTAIFIGGVAAMAGYWLTEKGDYML
DGFLKGR
Download sequence
Identical sequences G3N490
ENSGACP00000000110 69293.ENSGACP00000000110 ENSGACP00000000110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]