SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000120 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000120
Domain Number 1 Region: 3-172
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.97e-50
Family SPRY domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000120   Gene: ENSGACG00000000097   Transcript: ENSGACT00000000120
Sequence length 173
Comment pep:novel scaffold:BROADS1:scaffold_379:493:1011:1 gene:ENSGACG00000000097 transcript:ENSGACT00000000120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSCELTIDTNTVNKHLKLSDNNRKVTCVEEDQSHPDHPDRFDNYNQLLCRTGLTGRCYWE
VEWRGEVNVSVSYRGIRRKGNSRDCLFGYNDQSWSLRCSDKGYYVRHNETETLITYSSSG
RVAVYVDCPAGSLSFYRVSSDTLIHLHTFSTTFTEPLHPGFRFWSYGSSVSLC
Download sequence
Identical sequences G3N4A0
ENSGACP00000000120 69293.ENSGACP00000000120 ENSGACP00000000120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]