SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000483 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000483
Domain Number 1 Region: 87-137
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000471
Family TSP-1 type 1 repeat 0.00041
Further Details:      
 
Domain Number 2 Region: 273-327
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000034
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 3 Region: 142-193
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000157
Family TSP-1 type 1 repeat 0.00099
Further Details:      
 
Domain Number 4 Region: 30-84
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000641
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000483   Gene: ENSGACG00000000378   Transcript: ENSGACT00000000483
Sequence length 333
Comment pep:novel scaffold:BROADS1:scaffold_768:5725:9322:1 gene:ENSGACG00000000378 transcript:ENSGACT00000000483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRRCTTLEESTDMSQWKQNISVCPLRNQTIDGGFGPWAPWQPCNNDDGADGVSACLCRSR
SCDSPASRCGGRNCEGPAIEVSNCSRNGCWTPWSSWGQCSTTCGTGFELRQRSCSNPAPR
HGGRVCVGPSRDERFCNEGTSCPQPVFWSPWGSWTKCSTECGGGVHSRVRTCENGNSCPG
CALDYKACHLEACPEVKRSTPWTPWMPVNVTHGGARQEQRVRYLCRAHLPDPHELQIGRR
KVETRFCPNDGTAACETDVLVEELLKTPLVRGGAGWSSWETWSSCSQSCSKGYRTRRRSC
SGPEGKSPPVACRGSPVEYQDCNVQACPGESPA
Download sequence
Identical sequences G3N5B3
ENSGACP00000000483 69293.ENSGACP00000000483 ENSGACP00000000483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]