SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000536 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000536
Domain Number 1 Region: 3203-3314
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-30
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 3308-3419
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-30
Family Cadherin 0.00047
Further Details:      
 
Domain Number 3 Region: 3791-3988
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.65e-29
Family Laminin G-like module 0.0092
Further Details:      
 
Domain Number 4 Region: 990-1109
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-27
Family Cadherin 0.0011
Further Details:      
 
Domain Number 5 Region: 1518-1626
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-27
Family Cadherin 0.00061
Further Details:      
 
Domain Number 6 Region: 421-540
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-27
Family Cadherin 0.001
Further Details:      
 
Domain Number 7 Region: 3097-3201
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-26
Family Cadherin 0.00078
Further Details:      
 
Domain Number 8 Region: 2244-2350
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-26
Family Cadherin 0.00085
Further Details:      
 
Domain Number 9 Region: 1097-1229
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-26
Family Cadherin 0.0015
Further Details:      
 
Domain Number 10 Region: 885-999
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-26
Family Cadherin 0.0018
Further Details:      
 
Domain Number 11 Region: 1418-1522
Classification Level Classification E-value
Superfamily Cadherin-like 7.99e-26
Family Cadherin 0.0012
Further Details:      
 
Domain Number 12 Region: 2775-2888
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-25
Family Cadherin 0.00068
Further Details:      
 
Domain Number 13 Region: 2995-3103
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-24
Family Cadherin 0.00084
Further Details:      
 
Domain Number 14 Region: 109-230
Classification Level Classification E-value
Superfamily Cadherin-like 1.11e-23
Family Cadherin 0.001
Further Details:      
 
Domain Number 15 Region: 1727-1847
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-22
Family Cadherin 0.00082
Further Details:      
 
Domain Number 16 Region: 785-889
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-22
Family Cadherin 0.001
Further Details:      
 
Domain Number 17 Region: 679-791
Classification Level Classification E-value
Superfamily Cadherin-like 5.42e-22
Family Cadherin 0.0014
Further Details:      
 
Domain Number 18 Region: 2557-2662
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-21
Family Cadherin 0.0027
Further Details:      
 
Domain Number 19 Region: 2036-2143
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-21
Family Cadherin 0.0016
Further Details:      
 
Domain Number 20 Region: 2889-2993
Classification Level Classification E-value
Superfamily Cadherin-like 6.71e-21
Family Cadherin 0.0017
Further Details:      
 
Domain Number 21 Region: 1631-1733
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-20
Family Cadherin 0.0017
Further Details:      
 
Domain Number 22 Region: 3407-3522
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-20
Family Cadherin 0.0019
Further Details:      
 
Domain Number 23 Region: 2144-2251
Classification Level Classification E-value
Superfamily Cadherin-like 8.85e-19
Family Cadherin 0.0011
Further Details:      
 
Domain Number 24 Region: 2448-2555
Classification Level Classification E-value
Superfamily Cadherin-like 1.03e-18
Family Cadherin 0.0021
Further Details:      
 
Domain Number 25 Region: 1206-1316
Classification Level Classification E-value
Superfamily Cadherin-like 1.36e-18
Family Cadherin 0.0032
Further Details:      
 
Domain Number 26 Region: 2351-2451
Classification Level Classification E-value
Superfamily Cadherin-like 2e-18
Family Cadherin 0.0025
Further Details:      
 
Domain Number 27 Region: 1325-1424
Classification Level Classification E-value
Superfamily Cadherin-like 8.85e-18
Family Cadherin 0.0039
Further Details:      
 
Domain Number 28 Region: 1835-1958
Classification Level Classification E-value
Superfamily Cadherin-like 2e-16
Family Cadherin 0.0021
Further Details:      
 
Domain Number 29 Region: 1945-2048
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000842
Family Cadherin 0.0035
Further Details:      
 
Domain Number 30 Region: 532-631
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000228
Family Cadherin 0.0036
Further Details:      
 
Domain Number 31 Region: 2668-2782
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000657
Family Cadherin 0.0053
Further Details:      
 
Domain Number 32 Region: 4040-4083
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000335
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 33 Region: 6-121
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000126
Family Cadherin 0.0046
Further Details:      
 
Domain Number 34 Region: 4078-4118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000287
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 35 Region: 3520-3611
Classification Level Classification E-value
Superfamily Cadherin-like 0.000003
Family Cadherin 0.01
Further Details:      
 
Domain Number 36 Region: 366-433
Classification Level Classification E-value
Superfamily Cadherin-like 0.000003
Family Cadherin 0.015
Further Details:      
 
Domain Number 37 Region: 4003-4040
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000368
Family EGF-type module 0.014
Further Details:      
 
Domain Number 38 Region: 222-322
Classification Level Classification E-value
Superfamily Cadherin-like 0.00005
Family Cadherin 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000536   Gene: ENSGACG00000000415   Transcript: ENSGACT00000000536
Sequence length 4552
Comment pep:novel scaffold:BROADS1:scaffold_119:104045:203489:1 gene:ENSGACG00000000415 transcript:ENSGACT00000000536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LYFGFTLTVYRATLYENSAARTYANTKVKMGIYLAQRSWEIRYRITSGDDEGFFKVEEYV
LGDFCFLRIRTKGGNAAILNREIQDNYVLTVKASVKGDTLLETWTKVSIQVLDMNDLRPL
FSPTTYSVNIAESTPLRTSIAQVTATDADIGSNGEFYYFFKEKIELFAVHPTSGVVSLSG
KLNIDEQNQYDLEILAVDRGMKLYGNNGVSSTAKLLVHVERVNEHAPVMNVVAHSPSGLD
KNPVYAMVTVDDFDEGLNGEVDSVVIVGGDPSEQFFIERLTKGEFAVKASESFNRDTYPY
GCNLTLQAKDRGAPQKFSPVKVVHIMVKKKQTAEAVFERELYDLSLNEISPPGTIVEAVK
ISAEPDNVAYMMTPSADSAFFQINTLTGVISTTQWFTQVSQNVFNLELVEIDSDVKVKVR
VTIEDANDNPPTFDQASYEVLINESVLVGTNVLTVSAVDEDKGENGYITYSISSFQPLPF
KINQFSGIISITKELDFESSPESFVFLVRASDWGSPYRRESEVNVTIHLENVNDNQPLFE
MIACHGVISRDLAVNEVITTMSAIDIDELELVKYKILSGNERGYFDLNPDSGVLSLQNSF
VTASPMNGVFSLKITATDGENFAEPMFVNISVAQGKSPTSFNCRETRVAQKLAEKLLKKS
KASTKHKIEEGFIDLFSVNRQTPQFDKAFPTDISVWEDLKIGSSVFKVNAFDGDTGFNGQ
ILYSISDGNTDNCFTIDMETGLISVFLPMDREKRDRYLLNLTIYDLGLPQKTAWRLLTVY
IEDANDNAPQFLEEGGYSIVIPENTAIGTDVIQVEATDKDLGPNGEVVYSVLTGTSQFGI
NYTSGIVYVAGQLDREFVSTFNLKIEARDKGVKGGQKFSVITMKVILEDVNDCPPLFIPN
VYKARALEDLPVGTVVAWLETQDPDLGLGGQVRYSLANDYNGWFEVDRASGAIRLTKELD
YETQQFYNLTVKAKDKGRPVSLLSVTFVEVEVVDVNENLYAPYFSHFALTGLVKENARIG
TTLLQVTANDDDTGRDGDIQYSIHDGSGLGRFAIDGETGVIYTTDMLDRETKDSYWLTVY
ASDHGVVPQFATIEVFIQVEDVNDNAPLTSEPLYRPSVPENSPRDLSVIQIEAQDPDAVP
PSASDRLNYRITSGNPQNFFTINTRSGLITTTSRKLDREQQTEHVLEVLVLDGGPTPRQS
TVWVMVQILDENDNKPTFPEKVYQVKLPERERRKKGEPIYRVFAYDRDEGPNSDLSYSIV
DGNEEGKFFIDPKTAVVSSRKAFTAGSYDILTIKATDNGRPQKSSTARLHIEWIRRSPPS
TVPVLFDEPFYNFTIMENDKVAEIVGLVSLQQSSAPLWFDITGGNSDSIFAIEKAVGTIV
IAKLLDAEQRSFYNLTVQATDGTNTAYTQVHITVMDNNDNAPIFSQPTYDVTISEDTPPD
TEVVQVLATDRDEHHWLTYSLQSSIDSSSMRLFRIHPTVGTIYTAQRLDHEACAQHILTV
IVKDQEFPYRKNLARVLIEVEDINDHVPIFTSALYEGSVYESAAVGSAVVQVTALDKDKG
VNAELHYSIEAGNTGNTFHIEPILGIVTVARDLDLSSLGYYVLTIRVTDNGSPPLSTTTT
VRIAVTLSDNAGPKFPQPEYQAEITEMAVMGTSITTVSAASQSTLTYDIKQGNTDQVFQL
NQYSGVISTQKLLDYETTESYILIVQATNMAGMASNVTLIIQVVDENDNPPVFQQLHYHG
SISEAAPVNSLVLNSDDSPLVIKATDADRNQNALLVYQIVEETAKTFFTVDLGTGSIRTI
ANLDHETFAIFHFHVHVRDNGKSQLTAESPTEVTIQVLDTNDSPPRFTQNAYETVLLLPT
YVGVEALQVSAMDPDEDVPTGLTYSLTDGVLQYFAIKPSNGVITVKDNNFSKERFRFSVK
VSDGKFSSTALVTIIVRKALDSGLSFTNSLYTSSIQENVSNITKVAVVNAVGNRLNEPLK
YTLLNAGTGFKISPTSGVIQTTGIPFDREEHEFYELVVEARREHDRFHVARVMVTVHVED
INDNAPVFVGLPYYAAVQVDAQPKSSIFRVMAVDCDKGINGEVSYYLKDDHGHFEINQQT
GGLSLKKAFESDLSNMEYQMEIYARDGGYPPISSTIEFPITVVNKAMPVFDKPFYSVSVN
EDVAVHTPILGINATSPEGQNIIYTIVDGDPSLQFDIGFDTGVISVIHSLDYEAAASYHL
TIRATDYLTGARAEVDVDVVIQDVNDNQPIFQKMSYRVVLSETVMIGTPALQVIATDKDS
EKNNVVRYQIFSDEHNSTDYFHIDSSSGLILSARMLDHELVQKYDFIVRATDNGFPPMSS
EVSVIIVVNDMNDNPPVFNQLLYEAYVNELAPRGHFVTCVQASDADSSDFEKLEYSILSG
NERINFLMDNNTGILTVSGHRKQRMDLVYSLNVSVSDGVFTSTAQVHIKVLGANLYSPVF
GQNMYEAELKENAAVGTKVIQVKATDADPWLDHIIYSFVNDVGKDQFSIDENGQITTAEK
LDREDPANKDIVLAVAAQDPGGRVSYCTVQVTLLDDNDNVPCFRATEYRASVKSDVSKGF
LVTQIQAHDPDDGTNAKVTYSLYSEAHVPVVDILEIDPDNGWMVTKGSFSHLRNSVLSFF
VKAVDGGHPVRHSLVSVYIHVLSPDAFIPSFSQHQYFFSMPEDTPIGSAIGTVRLNISSG
YTFLPATFALVNGETVENNQNAVFVVERDTGVIMADKLLDYEMVKEYHLKVTATVQQAKV
DYVTSIYVEVKVLDLNDNKPAFETNSYEATVMEGMSIGTRIIQVQALDQDSGAYGQVTYH
LGTFIQSTGDLDTVVDTFSIDSNTGWISTRKDLDHETNPSYTFLVVASDLGETLSLSGTT
TVTIAVSDINDNPPMFLEQSYFGSVQESDPPGEVVAVLNTRDDDSSAVNRQVSYHITGGN
YRGVFALGLVQGEWKMYVKRPLDREDRNLYIINVTASDGLFVSQATVEVTVIDTNDNRPI
CDQAVYTASVSENLPVNSLLLRIGATDADIGVSAWIQYSLHGPGSQDFSIDPDTGEVKSS
IILDHEMTPCYRLIAQATDGGGRWCRAEVQLAVTDMNDNPPIFTLSQYTASVYEDTATKA
LLTRIQAIDPDEAGPGRMVVYSLADSAEGSFSIDKSSGIVILERILDREVQPTYQITVHA
SDQGSPLPLSSSVNVTITVLDINDNPPVFERRDQLATVPEDMGVGTEVLRIYAASKDIGT
NAEITYSIRSGNDHGKFHIHPLTGAILVARPLDYEACKEYFLTVEACDGGTPSLSAITTV
NINLTDVNDNAPMFSREIYTAVVSEDATTGDSVVQLLAEDVDSPVNGAILYSVVSGDQDS
QFFIDPLRGVIRVNKPLDRETVPSYSLAIRALDSGTPPMSSTVIVNIDVSDINDNPPTFF
PANLTTVIQENKPIGTSILQLSVNDQDSSRNGEPFDFHILSGNEGGEFVLEKDGTLVANQ
VFRRDLATEYAIIIQVTDSGKPRMSSTSMLTVRVIEESLHRPVALPLQVHIVTMEDEFPG
GVIGQLHATDADPYDALTFGHAPLAQRSLFKISPRDGKIIALGGLDAGRYALNASVSDGR
FAVPVPVSVHVEQVTPEMLREAVTIRFESVAPQDFVALHLKSMLKVLRKAASSQQRDKLH
LLSLQPVGGTQQLDMLVAVETAGGGYYKTAYLTQKLSASRRQLEEVLRVSAILDKNCSGL
ECRGAQCEQSILLDSHSLATYSTPRVSFVSPRFHRTSHCTCNGEGCYHLFKQCEGQPCPA
DMQCVSIQATRGHYACQCPTGKLGECAGHSSLSFSGNSYIKYRLSEWLQEELKVSLRIRT
LQRRGIIMYTHTEPCLVLKLEDGKLWFQLACGLGSDGGDNPDMLGISGHHINDGSWHTVA
LELNRNFSSVALDDSYVERRSAAPFTQPLSPDRSIYFGALVQPPNSRSLVDSQKDPQVLE
GFQGCLDSVTLNNNELPLQNKRSRYAEVVGLTDLKLGCILYPDACLQQPCRNAAICTSLP
SGGFSCTCKPQYTGGRCEMEITACIPNPCQNGGACRPIGNAFLCSCRRGFKGLICEEDVN
ECDQGNPDGECDNSGVCVNTYGSFYCNCTAGFVGQRCGLRPVVVPDMQAGHTVVGKEELI
GIAVVLLVIITLILLFIAFRKKVFQKNYSRNNLSLVQDPATAALLNKANGVQFKTLHCTP
GDPLHLYSETGHGAIVAGGGGMMGPPQVPVRPMAYTPCFQGDPRSTLEKLVDGRGVEHTE
MSTFHPESPRILSGTTRRGIVVCSVAPNLPPVSPCRSDCDSLRKSPWDDEGEMVDMAEEV
TCFSGSNKSSNSEVQSLSSFQSDACDDNAYHWDTSDWMPSTRLSDIEEVPGYEAGPGINV
AGTAPRLEGSTRELESDYYLGGYDIDSDYPHPHEEEFLSQDQLSPPLPTGEDYAELYVPL
PTNTPISKDSTLSSGSTGHQHALPRFHPSQYLPPHQMPVGEAPRGDFSSSINGISPGNGG
TDVGLSVGASSASGMFAHCSLDDSEHGSNFDSMDEICRGVTIITDSQQQTEV
Download sequence
Identical sequences G3N5G3
69293.ENSGACP00000000536 ENSGACP00000000536 ENSGACP00000000536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]