SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000862 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000862
Domain Number 1 Region: 3-173
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-51
Family SPRY domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000862   Gene: ENSGACG00000000669   Transcript: ENSGACT00000000862
Sequence length 174
Comment pep:novel scaffold:BROADS1:scaffold_147:15585:16106:1 gene:ENSGACG00000000669 transcript:ENSGACT00000000862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSCELTIDTNTVNKYLKLSDNNRKVTRVKEDQSYPDHPDRFDYFSQLLCRTGLTGRCYWE
VKWRGDVTVSVSYRGIRRKGDSEDCVFGHNDQSWSLMCSDEGYYVYQNNTVTRITSSSSS
GRVAVYVDCPAGSLSFYRVSSDTLIHLHTFSTTFTEPLYPGFGFWSSGSSVSLC
Download sequence
Identical sequences G3N6D7
ENSGACP00000000862 ENSGACP00000000862 69293.ENSGACP00000000862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]