SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000921 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000921
Domain Number 1 Region: 1-160
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-32
Family MAM domain 0.0026
Further Details:      
 
Domain Number 2 Region: 1684-1744
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000000818
Family BSTI 0.067
Further Details:      
 
Domain Number 3 Region: 2086-2146
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000687
Family ATI-like 0.017
Further Details:      
 
Domain Number 4 Region: 909-969
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000736
Family BSTI 0.089
Further Details:      
 
Domain Number 5 Region: 1295-1357
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000159
Family ATI-like 0.05
Further Details:      
 
Domain Number 6 Region: 530-585
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000106
Family BSTI 0.041
Further Details:      
 
Domain Number 7 Region: 2200-2235
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000201
Family EGF-type module 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000921   Gene: ENSGACG00000000704   Transcript: ENSGACT00000000921
Sequence length 2235
Comment pep:novel scaffold:BROADS1:scaffold_47:32115:76031:-1 gene:ENSGACG00000000704 transcript:ENSGACT00000000921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CDFNQDSEPFCRFTQDNTDRGDWTRHRGSTPTPGTGPSGDYPDGAGFYIYHEADNVANGQ
TSRLLSPPLSSAASQICVQFRYYMYGSDNQNVLRVLAKRPGSDDEVWKKIGIQSPSWLKG
SITVSKQSAQDIAIVFEAQRGFSSSCDTALDNIVISEGACPTPGPTTPKPPSVTSNPTPP
SPSVSSKMPPQQPLRGLCRPVSGVMLPSSPAKLQNVPQSKPSTPGPTTPKPSTPGPTTPK
PTTPRPTTPGPTTPKPPMFLFPPSPFIVFIGPTSPAQVNGTNVNLPITPASGVSVFKSAK
PSTPGPTTPKPSTPGPTTPKPTTPRPTTPGPTTPKPPTTRTNCVDCVEITMDTRKMTSVN
QMDQIITGQKLTNTNTHSFSNWLYVLTGVTSNPTPPSPTKPSTPGPTTPKPSTPGPTTPK
PTTPRPTTPGPTTPKPPTKPSTPGPTTPKPSTPGPTTPKPTTPRPTTPGPTTPKPPMLMT
LDTAGTLIPTKPSTPGPTTPKPSTPGPTTPKPTTPRPTTPGPTTPKPPTPKCPPNSHYEA
CADPCQETCSGKPPSCGGPCSESCVCDPGYVLSAGKCVKKTSCGCTHVNGQYYEPGDEFY
AEDCRLKCRCNAPFVTCKATECPPMQECKNQDGELGCYPTGSQDCVVSGDPHYNTFDKKF
FTFMGTCTYTLARTCKNTTGPWFSVEGKNEERGVPGMSYLRKLYVTVDGITVTLMKAKRT
LVNGRRVAFPNSPSPLISLSLAGQYVTLQTSFGLRVRWDGSHYAQISVPSSYYDQMCGLC
GDYDGNPGNDFTKPDGTLVGNVNDFGNSWQTKEDEDDSCSPGTKPDPDCDPKLEAEVVKP
DKCGKITDPAGPFRECISVVDPTPFFQSCVYDMCQFGGQQRVLCDQLQAYTDACQSAGAK
VHQWRTPGFCSLECPPNSSYTLCASSCPETCLGVVASPSCQDVCVEGCECNPGFILSNDK
CVSLKDCGCVDTSGTYHPVGDNWYLEGCEHKCDCHSGGLIQCHNSSCKPTTESCQLKDGE
YECLPLGNGICSVSGDPHYTTFDKHTHHYMGACSYTLSKPCNVSSGSPYFSVDTQNEHRG
SSKKVSYVRAVVVNVNGVTVVLGKGRTVQVNGTVVVPPVTSIGGVKIYLSGKFVVLETSF
GLRVRFDGNHHADVTLPISYNGLLCGMCGNFNGNSKDDNLKPDNTPAANTNELGDSWQVP
DPRPDCTNGGGQEDCDEVVEEEAKKPTSCGMITDPNGSLFKPCHVVVPPEPYFGNCVYDM
CATGGQTVALCQAIESYADLCAAAGVPIPWRNYTFCPLKCPAGSHYDSCSPACAQPSCQQ
PATPGGSCDLPCVEGCVCSPGLILSGDKCVPLSECGCTDTDGLYRPVGDSWFTETDCSER
CKCNGNNNITCEPWQCSPAQECKVVEGVLDCHSTGKGVCHVAGDPHYYTFDGVMHTFMGT
CTYTLVEVCNTTKVTPFKIVAKNEERGQPEASYVRSVKVYLPHDTVVELQKSRRVSLNGR
RVKTPLSIDLAGAKVITSGSYSLLDTNFGLQVKFDGVHHLEITVPGEYFNKLCGMCGNYN
HNSSDEYLMPNKKPAKDVIELGNSWKSDGDSDPGCQPDTRPNIHPNCTAEEEKLYEAQCA
GVILSDRFKPCHSLVPPEAFLGNCIYDLCEYDGMQATLCDNVDAYAQACQSSGVTISWRN
STFCPVPCPANSHYSDCTPPCPPTCSDLFPIFCHLPSTTCVEGCQCDGGYVLSDSKCVPL
DKCGCLGSDGEYHETRSLIIETIITRTCSCNLGGQITCKDHTCSSNSVCSLDKYGDVYCK
PTNFDKCSISGDPHHRTFDGFTHHFQGPYTYVLTQSHNLQNSLTPFVVRGKNMRRGGNRR
VSFLDQMYIDVYGVNVRFLQKKSVLLNGERVAPPLRPVDGLTITMNSKQVQLTTDFGLTV
RFDGNIRGEIILPSTYKNAVRGLCGNYDGITRNEYMKPDGTVVRDLNNFGESWRVSERQA
DAFWHSVSRREVEADPDSGFETSDCSQSELNGYNSVAQCGALSDSKGPFAACHATLPPKT
YQDDCVFDLCAESGNAALRCASYEAYAAACQEAGVKLEPWRQQLDCVLSCDANSTYSPCM
SPCPPSCADLAAPSECEATSCMEGCQCAAGFVMSEGVCVPYTQCGCSVLNRYYTLKEEFV
TEDCSQACECTSTGAVCRPKTCQSGFVCTVYDFKRECYRASPCLSYPCLNGGQCADASNN
TYTCQCAEGFEGDNC
Download sequence
Identical sequences G3N6J6
69293.ENSGACP00000000921 ENSGACP00000000921 ENSGACP00000000921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]