SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000924 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000924
Domain Number 1 Region: 183-437,477-517
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.8e-85
Family Protein kinases, catalytic subunit 0.0000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000924   Gene: ENSGACG00000000712   Transcript: ENSGACT00000000923
Sequence length 584
Comment pep:novel scaffold:BROADS1:scaffold_152:185828:189546:-1 gene:ENSGACG00000000712 transcript:ENSGACT00000000923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGAGCCFSSRKAGEPVFSPAHGGSQTASPGALPRLRNHNLTGGPRAAMSQAVQLSSQSQV
TQLYEENTNKRPVLTSQPNGLAPLGSTRPGLPLPDRQSSAPEPPNHCRQGSASSNKSTEG
KPKPSSLSPEQAMKQFMSKMSSLEHHEVFSYPEVYFVGPNAKKRSGVPGGANNGGYDDDQ
GSYIHVPHDHIAYRYEVLKVIGKGSFGQVVKAFDHRSQTHLALKMVRNEKRFHRQAAEEI
RILEHLRKQDKDSSMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRK
FAHSILQCLDSLHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRF
YRAPEVILGSRYGMPIDMWSLGCILAELLTGYPLLPGEDEADQLACIIELLGMPSQKLLD
ASKRAKNFVSSKGYPRYCTVTTLPDGTAMLNAGRSRRGKVRGTPGSKDWSVALKGADDPL
FLDFLKQCLEWDPALRMTPSQALRHPWLRRRLPKPPTGTTPGDKTSSSKRGAATTADGAI
TSLSKLATTSSTTASSSKTRTNLAAITDANGNIQPRTVLPKLVS
Download sequence
Identical sequences G3N6J9
ENSGACP00000000924 ENSGACP00000000924 69293.ENSGACP00000000924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]