SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001099 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001099
Domain Number 1 Region: 328-479,524-566
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-42
Family SPRY domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001099   Gene: ENSGACG00000000851   Transcript: ENSGACT00000001099
Sequence length 611
Comment pep:novel scaffold:BROADS1:scaffold_197:50068:59113:-1 gene:ENSGACG00000000851 transcript:ENSGACT00000001099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTSAAERAAASRAERGSEERRGRRPGSRAGPRPPRAAPAPTGSGSSGSCAPGSAAAPRVD
TESPGGKEGMEAAGEGSEAADALTGSGDEESGRQLGDVELQCALCMKWFTADTFAIDTAT
CLPFMTNYVFHCNVCHHSGNTYFLRKQANLKEMCLTALANLTWRSRTQDEHPKTMFPKDK
DIIPFIDKYWECMTTRQRPGKLTWPNNIVKAMSKERDVFLVKEHPDPGSKDPEEEYPKFG
LLDQDLGTIGPSYDSQKQTSAAPAAGGLNGALAPGPVKGRRAQTRSHQETPKVGDPHTHS
RPLFSAQRLPLSTDPLEHPFNKDGYRYILAPDPHAPDPDKLELDCWAGKPIPGDLYRACL
YERVLLALHDRAPQLKISDDRLTVTGEKGYSMVRASHGIRKGSWYFEVTVEEMPPDTAAR
LGWSQPLGNLQAPLGYDKFSYSWRSKKGTRFHQSIGKSYSSGYGQGDTLGFFIQLPDATE
TAKALPDTYKDKALIKFKSYLYFEEKDYVDKAEKSLKSMSSSRIIFFKNGVSQGVAYDNL
YEGMYFPAISLYKSCTVSVNFGPHFRHAPKDLKYQPMSDMGSGAVIEHTLADMLFHVETD
VDGRRSPPWEG
Download sequence
Identical sequences G3N724
ENSGACP00000001099 ENSGACP00000001099 69293.ENSGACP00000001099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]