SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001138 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001138
Domain Number 1 Region: 140-343
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.33e-62
Family Reprolysin-like 0.0000223
Further Details:      
 
Domain Number 2 Region: 362-438
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 1.96e-20
Family Blood coagulation inhibitor (disintegrin) 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001138   Gene: ENSGACG00000000876   Transcript: ENSGACT00000001138
Sequence length 666
Comment pep:novel scaffold:BROADS1:scaffold_157:1291:7559:1 gene:ENSGACG00000000876 transcript:ENSGACT00000001138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HPDRLQCGLEVGGRLFLLDLEKNHDLLPKPPNVFYYLPDGTGVSVRADPVTHCYYHGNIR
GFPHSRVALSTCSGLRGLIAFNSTLSFELQPQEDLHLHQLLFSTSPREGDATGGCGVSHT
AVPPLHSSTHTHRRKRDILSETKYIELVLVADHQEYLNYQKNNKTLIYRMLDVANQVDWF
YRPLSVRVALTGLEIWSDRDKIQVEKSPTDTLNNFLEWRTRELLPRLRHDNAQLVMGESF
DGTTVGMASQASMCSRDRSGGVNVDHLVSVLGVAATVAHELGHNLGMSHDTAERRCSCQN
EQRLGGCIMEPSTGFMPGQQFSSCSAADLSVSLLHGGGMCLFNVPQPDRLLGGPRCGNLY
VETGEQCDCGLLEECEDPCCNASTCQLVSGAQCSSDGICCQDCKLRAAGSVCRDPLGECD
LPEFCTGSSPYCPPNVFLQNGEPCEDDASYCYEGVCASMLTQCRMLWGPNATTAPPVCFS
SVNKQGNKYGNCGQLSNGSYLPCGNSDTHCGRIQCRGGRERPLLGTNAEILTTTVRFNHS
DLVCRGTFFHLGDDVSDPATVAQGTACGPGKACLNQKCQDVSVFQVEECRGKCNGHGLLH
NNKMCHCEAGRAPPDCRYSGHGGSVDSGPARAAGGTSAAPLSDAQRPPTQPVGTQVTSSP
MSLRLF
Download sequence
Identical sequences G3N762
69293.ENSGACP00000001138 ENSGACP00000001138 ENSGACP00000001138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]