SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001248 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001248
Domain Number 1 Region: 576-612
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000025
Family Ovomucoid domain III-like 0.0047
Further Details:      
 
Domain Number 2 Region: 662-700
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000236
Family Ovomucoid domain III-like 0.019
Further Details:      
 
Domain Number 3 Region: 706-736
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000416
Family Ovomucoid domain III-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001248   Gene: ENSGACG00000000965   Transcript: ENSGACT00000001249
Sequence length 919
Comment pep:novel scaffold:BROADS1:scaffold_37:1661282:1683419:1 gene:ENSGACG00000000965 transcript:ENSGACT00000001249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLATIKSESHLNHLLQRLPSYCPELMNELWTCINSSLPGVSRKSEGWVGLGCCELSISPE
CRRECRQASSKNDITKVCKKVTENSLYSCITKNEKVGSTCCSYAGRHTTCREYCQAIFRT
DSTPTVSQISAVKEYCQSHSPQLLSCVTNFTKSYPVRSPIDSLHCCDRAEATHCQVACRR
ILRTMSTEHEIMEGLINECGSQPLPQDPMWQCFLGSAHPASPPEVETPHPAKMDCAKLHC
CAKANTSMCRDTCQEISTNWGSQTGQDFDQFCEYNPVETELINCLADVREPCQLGCKDLT
YCTNFNNRPTELFRSCNVQSDQGAMSDMRLWSNGTIKMPVMNIPVLDIRKCLPDMWKAVA
CSLQIKPCHSKSRGSVICKSDCLDILTQCGDRKRFHEGQTPERICELLSPIDDPDRCIPL
HKYLTPSSLGNSVVDEVTHPCNPNPCPSNHLCQVNRRGCLDDLHCQPFLCVPAGCKLGEA
SEFLVQQDARIEVPTRTGLTGCHEVCTCGPSGRLENCAEMPCVDTDEPCIVGGERKNHGA
SFKIDCHTCSCFAGETTCSTRKCLDLDSSEEDRRRFTGRLPCNCPDRFVPVCASNGRTYP
SACVARCMAFKDYQFVFGRCRLGNPCAGSPCQRNQRCIPKYRVCLSDLSDCPQYECAGRP
GGCDRSGVEPACDTDGLVHASRCQLLQAGKTLAYMGPCQEACRKPQQVCGHNGETYNSVC
DAMADRVALDYEGPCHAVGAVSDAAPDSACSGIPCPPLSAPGCQPVTPPGACCPICASML
QILWSKEQMNTFSKLNKNQPVTVHDVLQILRLHVSVPQCDVFGYLSIDHELVVLIAPVEQ
QPTPLQIEACSKEAEKIDALINYASPTLVSHVPLSAFLTSEIQTSYVRSSGGAPPSPLHP
GLCLLLGLVIAAAPVLHQV
Download sequence
Identical sequences G3N7G8
ENSGACP00000001248 69293.ENSGACP00000001248 ENSGACP00000001248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]