SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001344 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001344
Domain Number 1 Region: 155-206
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000586
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 2 Region: 259-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000001
Family Laminin-type module 0.00018
Further Details:      
 
Domain Number 3 Region: 315-363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000151
Family Laminin-type module 0.0012
Further Details:      
 
Domain Number 4 Region: 213-261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000314
Family Laminin-type module 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000001344
Domain Number - Region: 118-157
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000136
Family EGF-type module 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001344   Gene: ENSGACG00000001039   Transcript: ENSGACT00000001345
Sequence length 365
Comment pep:novel scaffold:BROADS1:scaffold_1238:3624:5362:-1 gene:ENSGACG00000001039 transcript:ENSGACT00000001345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSYGQNLSLSFRVDRRDTRLSAEDLVLEGAGLRVAVPLIAQGNAYPNENMQTYVFRLHD
TADYPWRPTISQPDFQKLLHNLTAIKIRGTYSERSAGYLDDVSLVTARRAPGVPARWVER
CTCPQGYQGQHCEQCTLGYRRARQELGAFSPCEPCNCNGHSEACDPDTGACDCRDNTAGL
SCERCRDGFYGDATSGSSGDCEPCPCPAGATCAVVPKTREVVCTNCPAGTTGKRCELCDD
GFFGDPLGGAGPVRACRACKCSDNIDPNAVGNCDRETGECLKCIYSTAGFFCDRCKDGYY
SNALAANAADKCKPCSCSPSGTVGGQTSCSQVTGQCECLPNVAQRDCSVCQPGFFNLQSA
AGCER
Download sequence
Identical sequences G3N7R1
ENSGACP00000001344 ENSGACP00000001344 69293.ENSGACP00000001344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]