SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001350 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001350
Domain Number 1 Region: 275-458
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-66
Family SPRY domain 0.00000522
Further Details:      
 
Domain Number 2 Region: 16-85
Classification Level Classification E-value
Superfamily RING/U-box 1.25e-20
Family RING finger domain, C3HC4 0.0059
Further Details:      
 
Domain Number 3 Region: 92-149
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.49e-17
Family B-box zinc-binding domain 0.00065
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000001350
Domain Number - Region: 218-256
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.0191
Family Arc/Mnt-like phage repressors 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001350   Gene: ENSGACG00000001044   Transcript: ENSGACT00000001351
Sequence length 461
Comment pep:novel scaffold:BROADS1:scaffold_171:128656:130756:-1 gene:ENSGACG00000001044 transcript:ENSGACT00000001351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTPSTSRKNTQLVLYSDQFLCSICLDVFTDPVTTPCGHNFCMNCINEHWNTSDQNLCPMC
KKDFITRPDLRVNTFISEMVVQFRQSAQQKASSSRMCTKHDKPLELFCKSDQTCVCMLCT
ILDHKNHEYVPLEEEYEEKKVELKKKEAEIQQMIQKRRVKIQEIKHSVDLSEEDAGREKA
EGVQVFTDLMESVERGLKEFLKTIEEKQETTKKQAEAFIRELEEEISELMKRSAEVEQLS
LSEDHLHLLQSSNIHQPPPTKDWTEVSVCPSYEMKKKVQMFAVDLTLDPQTAHPRLILSD
DGKQVKLGDVEKNLPNNPERFSSWLCVLTKQSFSSGRFYFEVQVEGKTQWFLGVNRESVN
RKKIIPLRPQNGYWTICLINGNEYKALADPPVVLSVTSGPQKVGVFVDYEEGVVSFYDVE
AAALIYSFTGCSFTEKLFPFFCPGGYDGRNSAPLIISPVGV
Download sequence
Identical sequences G3N7R7
ENSGACP00000001350 ENSGACP00000001350 69293.ENSGACP00000001350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]