SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001378 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001378
Domain Number 1 Region: 1175-1402
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.76e-38
Family Laminin G-like module 0.0034
Further Details:      
 
Domain Number 2 Region: 225-337
Classification Level Classification E-value
Superfamily Cadherin-like 1.3e-30
Family Cadherin 0.00068
Further Details:      
 
Domain Number 3 Region: 330-435
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-28
Family Cadherin 0.00049
Further Details:      
 
Domain Number 4 Region: 641-753
Classification Level Classification E-value
Superfamily Cadherin-like 1.11e-27
Family Cadherin 0.00066
Further Details:      
 
Domain Number 5 Region: 1425-1621
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.53e-26
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 6 Region: 532-639
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-25
Family Cadherin 0.0013
Further Details:      
 
Domain Number 7 Region: 117-223
Classification Level Classification E-value
Superfamily Cadherin-like 6e-25
Family Cadherin 0.00061
Further Details:      
 
Domain Number 8 Region: 12-115
Classification Level Classification E-value
Superfamily Cadherin-like 8.42e-25
Family Cadherin 0.0012
Further Details:      
 
Domain Number 9 Region: 746-847
Classification Level Classification E-value
Superfamily Cadherin-like 8.57e-25
Family Cadherin 0.0012
Further Details:      
 
Domain Number 10 Region: 435-536
Classification Level Classification E-value
Superfamily Cadherin-like 9.57e-22
Family Cadherin 0.00082
Further Details:      
 
Domain Number 11 Region: 1115-1153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000342
Family EGF-type module 0.018
Further Details:      
 
Domain Number 12 Region: 849-951
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000928
Family Cadherin 0.01
Further Details:      
 
Domain Number 13 Region: 1748-1788
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000921
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 14 Region: 1619-1653
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000061
Family EGF-type module 0.012
Further Details:      
 
Domain Number 15 Region: 1654-1700
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000643
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000001378
Domain Number - Region: 1094-1124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00363
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 2228-2458
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00494
Family Rhodopsin-like 0.014
Further Details:      
 
Domain Number - Region: 1404-1435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0067
Family EGF-type module 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001378   Gene: ENSGACG00000001065   Transcript: ENSGACT00000001379
Sequence length 2567
Comment pep:novel scaffold:BROADS1:scaffold_27:3072347:3117077:-1 gene:ENSGACG00000001065 transcript:ENSGACT00000001379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSRRKRRSINSSPQFQPPMYQVSVAENQPSGTSVVVLKAVDGDEGEAGRLEYFIEALFDS
RSNNLFAVDPANGYVSTVEVLDRETKDTHVFRVTAVDHGVPRRTAMATLTITVRDTNDHD
PVFEQQDYKESIRENLEISYEVLTVRATDGDAPVNGNILYRIVNTNGSNDVFEIDSRSGV
IRTRGLVDREEVEAYMLLVEANDQGRDPGPRSATATVHIVVEDDNDNAPQFSEKRYVVQV
PEDMTPNTEILQVTATDRDRGSNAVVHFSIMSGNTRGQFYIDAQTGNMDLVSHLDYEANK
EYTLRIRAQDGGRPPLSNISGLVTVQVLDVNDNAPIFVSTPFQATVLENVPPGYSIIHIQ
AVDADSGNNSRLEYRLTETTPNFPFTINNSTGWLVVASELDRESVDFYNFGVEARDHGYP
VMSSSASISMTILDVNDNNPEFTQKGYYMRLNEDAVVGTSVVTVSAVDQDINSVVTYQIS
SGNTRNRFSITSQSGGGLITLALPLDYKLERQYVLTVTASDGTRLDNAKVFVNVTDANTH
RPVFQSSHYTVNINEDRPVGTTVVLISATDEDTGENARITYYMDDSIPQFDIDPDTGAVT
TRMELDYEDQVSYTLAITARDNGIPQKSDTTYLEILVNDVNDNSPRFLRDHYVGSVMEDV
PVFTSVVQVSAIDRDSGLNGRVFYTFQGGEDGEGDFIIESTSGIVRTLRRLDRENVPVYT
LQAFAVDKGVPALRTAVNIQVTILDVNDNPPVFEKDEFDIMVEENSPIGIVVAHILATDP
DEGSNAQIMYQIVEGNIPEVFQLDIFSGELTALTDLDYETRSEYVIVVQATSAPLVSRAT
VHVKLVDKNDNVPMLKNFQIIFNNYVTDKSSSFPTGVIGRIPAHDPDVSDQLHYSFEVGN
ELKLVLLNQSTGEIQLSPALDNNRPLEAFMRISVTDGVHSVSAQCLLQVTIITDEMLSNS
ITLRLANTSQERFLSLLLAQFLDGVARVLSAAPEDVVIFNVQDDTDVSARILNVSLSVAV
ESGGEFFGSEELQERLYLNRSLLARISSQEVLPFDDNICLREPCENYMKCVSVLKFDSLA
PFVASDTILFRPIHPIAGLRCRCPAGFTGDYCETEIDLCYSKPCGPHGVCRSREGGFTCE
CLEDYTGERCELSSRSGRCAPGVCKNGGSCVNLLVGGFKCDCPAGGYEKPYCEMTTRNFP
PHSFLTFRGLRQRFHFTLSLTFATKDPDGLLLYNGRFNEKHDFLAMEIINEQIQLTFSAG
ETKTTVSPYVLGGVSDGQWHVVEVHYYNKPILNQAGLPQGPSDQKVAVVTVDNCDASVAF
RFGHVIGNYTCSAQGSQSGSKKSLDLTGPLLLGGIPKLPEDFPVRSRQFVGCMKNLRIDN
QHIDMAGFIANNGTLPGCSAKRHFCNNDPCLNGGTCVNLWGSFSCDCPLGFGGQNCERVM
ASPQRFLGNSVLQWNNMAAAASSVPWHVELMFRTRQASATLLHISAGQQHNLTLQLRGGS
VLMGLHRGEDSTLSRVEEVLVNDGDWHHLQLDISSLEGAASHHKAVLSLDQGLYLASMEV
DGKLRDSKLKTVSVGGLERTDGKIQHGFRGCIQGLRVGGALSLSQARKVNVEAGCNVPDP
CSSSPCPASSYCSDDWDSHSCTCLAGYYGTNCTDACSLNPCEHESTCTRKPSSSRGYTCD
CPKNYFGRYCEKKTDLPCPRGWWGHKTCGPCSCQTDKGFDSDCNKTSGECRCKDNHYLPE
GSDTCLLCDCYPVGSFSRACDRESGQCQCKPGVIGRQCDHCDNPFAEVSPNGCEVIYDSC
PQAIEAGIWWPRTKFGLPAAVHCPKGTLGTAIRHCDEHKGWLPPNLFNCTSVTFSKLKAL
SEKFSRNTSLLDSGHVQQTAAMLANATLHTEKYYGSDVKVAYRLTQSLLQHENKQQGFNL
TATQDVHFTENLVRVGSAILSPDTRTHWELIQHSEGGTAALLRHYEEYANTLAQNMRQTY
LSPFTIVTPHIVISVDRLKKMNFAGAKLPRYQSLRGPRPADLETAVTLPDSVFQPPVDTK
GHRHLDVFPESSLKNRSANRKRRHPDDDQPDAIASVIIFHSLASLLPESYDPDKRSLRVP
KRPVINTPVVSITVHDNDELLQHALDKPITVQFRLVTTEERSKPICVFWNHNILGGNGGW
SAKGCEVVFRNGTHISCQCYHMTSFAVLMDISRRENGEILPIKILTWSTVGVTMGFLFLT
TIFLLCLRAMQCNKTSIINNGAVALFLSELIFILGINQADNPFMCTVIAILLHFFYLCTF
SWLFLEGLHVYRMISEVRDINYGPMRFYYLIGWGVPAFITGLAVGLDPEGYGNPDFCWLS
MYDTLIWSFAGPIAMVVSMNVFLYVLSSRASCTMRHHSIEKKEPRVSGLKTAGGVLLLVS
VTCFLALLSVNSDMIIFHYLFAGFNCVQGPFVFFFRVVFNKEARNAMKYCCSRKRPDHMI
KSKASFLSFQGYKCNTNYMDGRLYHLPFGDSSVSLNGTMQSGKSQQRDDGLSNSQAHIAL
NDHTSLFHETKDLDDHDSDSDSDLSLEDDQSGSYASTHSSDSEDEEG
Download sequence
Identical sequences G3N7U4
ENSGACP00000001378 ENSGACP00000001378 69293.ENSGACP00000001378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]