SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001686 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001686
Domain Number 1 Region: 35-356
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.32e-124
Family Bee venom hyaluronidase 0.0000137
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000001686
Domain Number - Region: 419-438
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00163
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001686   Gene: ENSGACG00000001294   Transcript: ENSGACT00000001687
Sequence length 461
Comment pep:novel scaffold:BROADS1:scaffold_27:3603787:3606707:1 gene:ENSGACG00000001294 transcript:ENSGACT00000001687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLAHWKALLLTVLLWDHLCALGLKPTRWPLYSQKPLLLAWNAPTEDCGPRHGIRFQLDLF
QIVASPNEGFVRQNLTIFYKDRLGLYPYIEPDGTTINGGLPQMASLTKHLDKMPEGVQKY
IREYGAKGLAVIDWEEWRPLWVRNWETKDVYRSYSREFVRQKNPTWPPEQVGKVALQEFE
MSARKFMLETLRYAKNLRPNQLWGFYLFPDCYNHDYVRTLENYTGRCPDVEVSRNEQLKW
LWMESTALFPSIYMAAALRSSESGRQFVRNRVKEGMRLASFGDGLARPVFVYARPTYTNS
LERLTETDLVSTIGESVALGAAGIIMWGDAAYTSSRNSCSDLDSYLRGALSQYLLNVSTA
AELCSQTLCASRGRCLRRNPDSDAYLHLSPAGHRILTPPGKPPAVVGELVSAEKGRFQSQ
FQCQCYSGYQGERCDQTDPLHQRAAASQVAPCAALLVVSLL
Download sequence
Identical sequences G3N8Q0
69293.ENSGACP00000001686 ENSGACP00000001686 ENSGACP00000001686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]