SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001824 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001824
Domain Number 1 Region: 355-539
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.14e-63
Family SPRY domain 0.00000606
Further Details:      
 
Domain Number 2 Region: 9-79
Classification Level Classification E-value
Superfamily RING/U-box 5.61e-21
Family RING finger domain, C3HC4 0.0054
Further Details:      
 
Domain Number 3 Region: 142-206
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.14e-18
Family B-box zinc-binding domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001824   Gene: ENSGACG00000001407   Transcript: ENSGACT00000001826
Sequence length 544
Comment pep:novel scaffold:BROADS1:scaffold_943:1268:3001:-1 gene:ENSGACG00000001407 transcript:ENSGACT00000001826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASANYGPSEDQFLCSICLDVFTDPVSTPCGHNFCMNCINKHWNTSDQNLCPMCNKDFIT
RPDLRVNTFISEMVVQFRQSAQQKASSSSSEQQESKPGEVPCDVCTGTKVKALKSCLVCL
FSYCETHLEPHLTVSRLKRHQLMDPVENLEGRMCTKHDKPLELFCRSDQTCVCMLCTILD
HKNHEYVPLEEEYEEKKVELKKKEAEIQQMIQKRRVKIQEIKHSVDLSEEDADREKAEGV
QVFTDLMESVEKGLKELLKTIEEKQEATKKQAEAFIRELEEEISELMKRSAEVEQLSLSE
DHLHLLQSSNIHQPPPTKDWTEVSVCPSYEGTVVRAVSQLEETLSNKMKKWFAELKRVQM
FAVDLTLDPETAHPELILSDDGKQVKDSDVEKKLPNNPKRFSSWHCVLTKQSFSSGRFYF
EVQVEGKTLWDLGVNRESVNRKGFISQSPQDGYLIICLINGNEYNAVDDPPVVLSVTSGP
QKVGVFVDYEEGVVSFYDVEAAALIYSFTGCSFTEKLFPFFCPGFNDDGINSAPLIISPV
GYHD
Download sequence
Identical sequences G3N936
69293.ENSGACP00000001824 ENSGACP00000001824 ENSGACP00000001824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]