SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001982 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001982
Domain Number 1 Region: 135-379
Classification Level Classification E-value
Superfamily vWA-like 5.56e-80
Family Integrin A (or I) domain 0.000000366
Further Details:      
 
Domain Number 2 Region: 379-464
Classification Level Classification E-value
Superfamily Integrin domains 5.02e-25
Family Integrin domains 0.0012
Further Details:      
 
Domain Number 3 Region: 630-710
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.000000000000876
Family Integrin beta tail domain 0.0047
Further Details:      
 
Domain Number 4 Region: 29-87
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000732
Family Plexin repeat 0.0025
Further Details:      
 
Domain Number 5 Region: 547-585
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000053
Family Integrin beta EGF-like domains 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000001982
Domain Number - Region: 589-628
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000153
Family Integrin beta EGF-like domains 0.024
Further Details:      
 
Domain Number - Region: 509-548
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000614
Family Integrin beta EGF-like domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001982   Gene: ENSGACG00000001519   Transcript: ENSGACT00000001985
Sequence length 782
Comment pep:novel group:BROADS1:groupXVI:427012:442049:-1 gene:ENSGACG00000001519 transcript:ENSGACT00000001985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKSRFAVFYWIGLLCWLLFQNQRASQQEEVCSKSVVNSCDDCIKSGPFCVWCKQLDFTKP
GEQEAVRCDTKAQLTGRGCTEGEIISPQNDQTIDKGESLSESFNNQEPIQLSPQKISLRL
RSGSPNTFKVSFKRVEGYPVDLYYLMDLSYSMKDDLENVKELGKDLFAALKKITEHAQIG
FGAFVDKTVLPYTNTNKEKLLKPCDENDQQCQAAFGYRHVLSMTPKEDDFKNKVTEQFIS
GNLDSPEGSLDAMMQAAICGDKIGWRNSSTRLIVLTTDAGFHMAGDGKLAGILEPNDEHC
HMDNNLYTNSAEMDYPSVGQLAVQLEKNNIQPIFAVTKNVEDVYKELSQMIPKSEVGVLS
TDSKNVVKLIESAYNRLSSKVTLTHDNLPDNVQVIYTPKCKHPGPSGETEGVCENVQVGQ
EISFDVTVTAYSCMKDKSFTIRPQGIKDTLTVTISTNCECQCSDPGPSGHTHCRGKGNVS
CGICSCREGSIGQFCECDVGGKDEPALRASCQRHNGTECEGRGDCVCGRCECHTTEGGNS
YYGDFCECDDEHCEKFQNKLCGGNGNCKCGKCECFKSHEGSACQCGVSEEGCRTPNNTVC
YGRGTCKCNRCECKEGYQQPRCQTCLGCTDPCQTKLNCIECLGFESGPFKKNCSEACVSI
HHVMVDQSTIQSKKCHQKDSEGCWFYYLEKINRKIQLSVLIRLPPDCPAPPSIAAIISGS
IASVALIGILLLMLIKLVIYTKDLKEFKKFEIEKKNSKWTDGVSPMFLSATTTIENPTFT
GE
Download sequence
Identical sequences G3N9J2
69293.ENSGACP00000001982 ENSGACP00000001982 ENSGACP00000001982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]