SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002031 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000002031
Domain Number 1 Region: 33-354
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.16e-123
Family Bee venom hyaluronidase 0.00000712
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000002031
Domain Number - Region: 415-432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0105
Family EGF-type module 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002031   Gene: ENSGACG00000001553   Transcript: ENSGACT00000002034
Sequence length 466
Comment pep:novel scaffold:BROADS1:scaffold_27:4476713:4479755:-1 gene:ENSGACG00000001553 transcript:ENSGACT00000002034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLSFSWQFIILTRSADTWIYLKQTRWPLFSQMPVLLAWNAPTQECAPRHRVTLSLNQFDI
VASPNEGFVGQNLTIFYKERLGLYPFYQHGGTAVNGGLPQLASLTQHFKKMPEGLQKYIR
RLDAKGLAVIDWEEWRPLWIRNWDTKAIYRNKSREMVASKNPKWTPEQVEKVAEQEFELT
ARKFMLDTLKFAKNSRPNQLWGFYLFPDCYNHDYKSGLKNYTGHCPDKEIKRNDQLNWLW
TECTALFPSIYIGSGLASANGGRLFVRNRVKEAMRLAAVGKGSARPVFVYTRPTYINEMT
LLTQTDLVSTIGESVALGAAGVIFWGDTSYASSHANCHSLNNYIEGDLGRYLLNVSTAAK
QCSRLLCNLHGRCQRKVQDKDVYLHLSPLTHSITSQGGRLTVTGVPSHAELAFFHTHFKC
QCYNGYRGETCAEKEKGQNRASSVLGTWPLCFLLPLGLLTLIHALV
Download sequence
Identical sequences G3N9P0
ENSGACP00000002031 69293.ENSGACP00000002031 ENSGACP00000002031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]