SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002049 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000002049
Domain Number 1 Region: 17-62
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000477
Family EGF-type module 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002049   Gene: ENSGACG00000001567   Transcript: ENSGACT00000002053
Sequence length 143
Comment pep:novel scaffold:BROADS1:scaffold_27:4601334:4603649:-1 gene:ENSGACG00000001567 transcript:ENSGACT00000002053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGAARCRRCASGYTLTGSKCVDVDECSDRILACRGLDEICTNTEGSFRCDCAEGFVRR
DAVCVKKQHPGVQEKGLFEDIQDDEVEVLQQMLFGVVLCALATLAAKGDLVYTSVFMGAV
AAMAGYWLSDRGDRLLGSLLKGR
Download sequence
Identical sequences G3N9Q8
ENSGACP00000002049 69293.ENSGACP00000002049 ENSGACP00000002049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]