SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002193 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000002193
Domain Number 1 Region: 485-535
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000114
Family Laminin-type module 0.0033
Further Details:      
 
Domain Number 2 Region: 21-59
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 3 Region: 70-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000229
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 4 Region: 446-487
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000949
Family Laminin-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000002193
Domain Number - Region: 349-389
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000363
Family EGF-type module 0.081
Further Details:      
 
Domain Number - Region: 833-946
Classification Level Classification E-value
Superfamily Tropomyosin 0.0209
Family Tropomyosin 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002193   Gene: ENSGACG00000001675   Transcript: ENSGACT00000002199
Sequence length 1155
Comment pep:novel scaffold:BROADS1:scaffold_120:284160:295979:-1 gene:ENSGACG00000001675 transcript:ENSGACT00000002199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLAVLLCGLRASAHYSTGRCDCNGRSQYCLRDAGGLHCVNCQGNTAGRHCERCKDGFNL
VGAALSCTPCRCNPAGSVGVTCDRTGRCSCKDGVTGEKCDRCPDGPVGPNGCSQRLRNPS
NNSFQCFNFKYFCSDFLFVLAFRRQPREDSGSQMCFCYGHSSKCSPQSGYSIHSITSTFA
EGLDGWWVATARGVIPDDVHFRWSPKHHDLEVISKNSLPVYLYAPAPYLGNQLLSYGQNF
SFSLRLDRGVRHPSTSDVVLEGGGLRVAASLGDLRSLVPCGQKINYSFRLDEQPGSRWKP
QLSASQFQTLLQNLTAVKIRATFGENGRGYLANVRLVTAQRADGAPARWVQTCSCPPGYD
GEFCERCSPGFRRRNPAEGAFSRCEPCSCRGGGCDPQTGDCYSADETPGERGCPEGFYRD
PWQPGACVRCPCMEGVSCSLPAGSLVARCDRCPTGTTGPRCNTCMEGFYGAPPRGDVEQQ
TCRPCQCNGHIDVGVAGSCDRSSGECLRCLNNTRGSGCQDCVPGFYHQRATDACKPCDCD
LQGSESRQCDDSGRCRCRTGYEGLRCLRSDCPACFSPIRTKMEAYAGKLKQLELLLSDKD
AAGLNPDSRDQMEATLRGIEELVDDLQYDTELLEGLEKSLQSRLSSISRSQLADGRLLQN
IGAAAGKVERQQQTYKTKVEEVRSLMKEMKRKLDEAKADLRSAEIPLGDALQGSDVFSSL
KEMAISLADKHTATADEVQRSANEALSNSERSLALVRTLMNKENKHNDIQRGWYDKNSAQ
VKGLENQATRLSGEAADESNMANGMLKEIANMERNLPLPLNVHILFSHHAQGQADNMVTR
LDDLKQAVDADVSSLEALQDDVQRNKAVTGDLLAAGKDAQQTFNKLLDRVNVAKTDTEEA
LRRINGNTKELDDALSTLRGFDQQIEDSRSLADTAIKRLPGINATVQQAVRNNADTDAVL
RDVSKDFDEALGTISVLGDLVTGLEGTFGSLPPLTGLMNEATKLNKDSQDLKKKASNTAG
LVESQLNEGRMLEAGAQEAAVEATEALNNAIRTRDSVGKTLSDIRRLLANFNQTGAVDET
QLERLEKSVADARNDVDSRLGPRLRDMEEQEEAQRRRLSGINLDIDAILVDIENLEDILK
AVPKGCFNSPPIEEA
Download sequence
Identical sequences G3NA51
ENSGACP00000002193 ENSGACP00000002193 69293.ENSGACP00000002193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]