SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002269 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000002269
Domain Number 1 Region: 1-104
Classification Level Classification E-value
Superfamily TIMP-like 2.28e-23
Family Netrin-like domain (NTR/C345C module) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002269   Gene: ENSGACG00000001742   Transcript: ENSGACT00000002275
Sequence length 106
Comment pep:novel scaffold:BROADS1:scaffold_232:44159:46829:1 gene:ENSGACG00000001742 transcript:ENSGACT00000002275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEITQVIKLGIEAGVEVGQRRLFMSHGGCRDGLVLNQGSQYLIMGPTEDQWNADADTGRS
VYVLGKDTWVERWPSPTECSSTDGLSDKCRSLKDAATELSVNGCRL
Download sequence
Identical sequences G3NAC4
69293.ENSGACP00000002269 ENSGACP00000002269 ENSGACP00000002272 ENSGACP00000002269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]