SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002529 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000002529
Domain Number 1 Region: 366-407
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000137
Family Integrin beta EGF-like domains 0.019
Further Details:      
 
Domain Number 2 Region: 452-489
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000067
Family Integrin beta EGF-like domains 0.01
Further Details:      
 
Domain Number 3 Region: 95-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000921
Family Integrin beta EGF-like domains 0.039
Further Details:      
 
Domain Number 4 Region: 287-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Integrin beta EGF-like domains 0.042
Further Details:      
 
Domain Number 5 Region: 192-221
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000279
Family Integrin beta EGF-like domains 0.02
Further Details:      
 
Domain Number 6 Region: 55-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000949
Family Integrin beta EGF-like domains 0.016
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000002529
Domain Number - Region: 142-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00013
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Domain Number - Region: 230-266
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000502
Family Integrin beta EGF-like domains 0.021
Further Details:      
 
Domain Number - Region: 414-453
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00279
Family Integrin beta EGF-like domains 0.01
Further Details:      
 
Domain Number - Region: 327-364
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00363
Family Integrin beta EGF-like domains 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002529   Gene: ENSGACG00000001943   Transcript: ENSGACT00000002537
Sequence length 496
Comment pep:novel group:BROADS1:groupXVI:3068290:3098481:1 gene:ENSGACG00000001943 transcript:ENSGACT00000002537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLNMHSGVSLQSMSVPLFLILLSAVEDTLSQSVSNLMLTCQVGGVCRLSAESSLRRCRTP
DGKICSGKGKCDCGICTCLATAPGKFYGPRCECHDWVCATFKEKTCNDRGYCDCGTCECD
EGWFGEACQFQEECELSGKKSKELCRNPQGVVCSNRGTCHCGSCMCDNKDSGGLVTGHFC
ECDDSECLDEENGEVCGGHGQCYCGNCYCAAGWHGDKCEFQCDISPWESKRKCTSPDGKI
CSNRGTCVCGECNCHDVDPSGDWGDIHGDTCECDERNCHATYDRYSDDFCSGHGQCNCGR
CDCKEGWSGKKCEHPLSCSQPAESSLKKCRGTSNLPCFGRGQCRCGQCTCYPPGDSRVHG
KNCECDDRQCEDIGGEICGGHGYCSCGRCICEDGWFGKLCQFQRSCDMSDVQSKELCETS
DGVLCSGKAGSCHCGKCICSPQDWWVSGEYCECDDRECDKHDGLTCTGNGLCSCGNCECW
DGWTGNACEIWVGEEY
Download sequence
Identical sequences G3NB33
69293.ENSGACP00000002529 ENSGACP00000002529 ENSGACP00000002529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]