SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003026 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003026
Domain Number 1 Region: 212-414
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.7e-49
Family Reprolysin-like 0.0018
Further Details:      
 
Domain Number 2 Region: 508-559
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000759
Family TSP-1 type 1 repeat 0.00031
Further Details:      
 
Domain Number 3 Region: 864-922
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000889
Family TSP-1 type 1 repeat 0.006
Further Details:      
 
Domain Number 4 Region: 802-860
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000432
Family TSP-1 type 1 repeat 0.0061
Further Details:      
 
Domain Number 5 Region: 922-966
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000124
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003026   Gene: ENSGACG00000002323   Transcript: ENSGACT00000003037
Sequence length 1046
Comment pep:novel group:BROADS1:groupV:705049:730584:-1 gene:ENSGACG00000002323 transcript:ENSGACT00000003037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIVPFSTDSRGRYISHVVSAGSGSKGGAADRRRVARHAPGVPPVTPVTPAPSQHLFFNVT
VFGKELHLRLRANRRLVAPGASVEWQEDFVEKTKERIHGDCVFTGDVSDMPEASVAISNC
DGLAGLIRTDNGEFFIEPLEKGQQDVEVKGRVHVVYRRSAIKRETGQRREDLHNEGIVAD
FGIADLPAALDLVEQKLPESERKRRHAKKDDYNIEVLLAVDDSVVRFHGKEHVQNYVLTL
MNIVDEIYHDESLGTNINVVLVRMIMVGYRQSISLIERGNPSRSLEQVCRWANTQQRRDP
DHAEYHDHAIFLTRQDFGPAGMQGYAPVTGMCHPLRSCTLNHEDGFSSAFVVAHETGHVL
GMEHDGQGNRCADETSMGSIMAPLVQAAFHRYHWSRCSKQELNRYIHSYDCLLDDPFEHK
WPKLPELPGINYSMDEQCRFDFGVGYKMCTAFRTYDPCKQLWCSHPDNQYFCKTKKGPPV
DGTECAPGKWCFKGHCIWRSSQQPQGHDGSWGSWSKFGSCSRTCGGGVRSRSRQCNNPAP
AYGGRDCPSSAFDYQMCNTEECAGPYEDFRAQQCIQRSNKYHKNIKHTWLPYEHPDEARK
CEMSCKSKETGEVVFMNQVMHDGTRCSYSEPFRVCARGECLHVGCDKEVGSYKQEDKCGV
CEGDNSHCRTVKLTLTKTPKKNGMLKMFDIPIGARHIVIEENETSPHIIAVKNQVTGNFI
LNAKSEDAETKTFIENGLQWEYSLDGAKEILETTGPLYEAIVVLVIPMEEDSKISLTYKY
IIHEDLLPLITNNNVLLAELDTYEWALKSWSQCSKPCGGGIQYTKYGCRRRSNSRLVHRN
FCETSKKPKPIRKRCNVQECSQPTWMVEEWSPCSKTCGKLAYQTRAVQCMQALHNGTNRP
VHSKHCTEDRPEARKVCNHTACPAQWRTGAWSQQCSVTCGEGIQQRQVVCKASDNTIGEC
EGEKPETVLICKLISCPASCSNIFLPYFVLQLHQRTPENPVHKISSNEPCLGDKSIFCQM
EVLARYCSIPGYNKLCCESCNKKENL
Download sequence
Identical sequences G3NCH6
ENSGACP00000003026 69293.ENSGACP00000003026 ENSGACP00000003026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]