SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003215 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003215
Domain Number 1 Region: 46-186
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.77e-44
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00043
Further Details:      
 
Domain Number 2 Region: 160-346
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.92e-37
Family Laminin G-like module 0.0023
Further Details:      
 
Domain Number 3 Region: 798-972
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.81e-34
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 4 Region: 980-1192
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.87e-30
Family Laminin G-like module 0.0056
Further Details:      
 
Domain Number 5 Region: 368-542
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.78e-22
Family Laminin G-like module 0.0066
Further Details:      
 
Domain Number 6 Region: 589-647
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.00000000921
Family Fibrinogen C-terminal domain-like 0.0035
Further Details:      
 
Domain Number 7 Region: 560-597
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000106
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003215   Gene: ENSGACG00000002461   Transcript: ENSGACT00000003226
Sequence length 1334
Comment pep:novel group:BROADS1:groupXXI:5398046:5560806:1 gene:ENSGACG00000002461 transcript:ENSGACT00000003226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFILFYSLRMVFKNEPLKASLYNQHCALHILSTSTEKCDEALASPLPHTAFTSSSVFSNG
YAPGYAKLNRRGGAGGWSPLDSDHYQWLQVDLGSRKQVSAIATQGRYSSSDWTTRYRLLY
SDTGRNWKPYHQDGNIWAFSGNSNSESSVRHELQQGIMARFLRLVPLDWSEEGRIGLRVE
VYGCSYWAGVINFDGQGVISYRFKVKKMKIIKDVIALRFKTSESDGVILHGEGQQGDYIT
LELRMAKLLLQINLGSNQYGSILGHTSVTTGSLLDDNHWHAVVIERYRRNVNFSLDSHTQ
HFRTNGEFDHLDLDYELSFGGMPYSGKPVGGGRKNFKGCMESINYNGDNITDLARRKKLD
TSSFRNLSFSCVETHTFPVFFNATSFLQLPGRANHDTISVSFQFRTWNPDGLLLFIDINI
INNGLLSRESNDMVGKCKSNLWLMSSLPQDVLPTGSGLNDGQWHAIRLVAKENFAMLTID
GEEASAVRSTLPLTITTGGTYHLGDLCDRGFFSPCKTALRTFQGCMQAILVDDQAADLHA
VEKGTVGAFENISLDMCAIIDRCMPNHCEHGGRCKQTWDSFSCTCDGTGYTGATCHTSIY
EPSCEAYKHLGRSSDTYWIDPDSSGPLGPFKVNCNMTDDKVWTTVMNNLPPKIAVTGSSR
ERRTVLQVNYSTSMEQVTAITTSAEYCEQQIAYSCRMSRLLNTPAGSDIESHVAKSKATC
VYWGLVSGEFQGCVCKCSGMILYSSYGCNTDALRRAYAREDSGPLTYKEHLPVSQVAVGD
TNRPGSEAKLTVGPLRCQGDNNYWNAASFTTPSSYLHFATFHGETSADISFYFKTSAPYG
VFLENLGNTDFIRLELKSPKVISFSFDVGNGPVELTVHSAAPLNDDQWHRVSAERNVKES
VLQLDQTQRASRLAPAQGHTRLELFSQLYVGSAAGGQRGFLGCIRALRMNGITLDLEERA
KVTPGVKPGCQGHCTSFGMYCRNGGKCVERYNGYLCDCSTTAYDGPFCTRDVGGFFEAGT
LVKYNFMPQAVAGASRDSKTLTRQQAPHEVNLTKEEVAFSFSTSNAPAILMYVSSKTQDY
LAVVLRQNGSLQVRYYLGGLKEPFSIDVDQRNLANGQPHSINMSRVDRSITIQLDHYPAV
SYTLPDESDTQFSLVKTLFLGKVFETGHIDPDLIKRYNTPGFIGCLSRVQFNGVAPLKTA
LRAPPAAASPVSYQGKLVESNCGSSPLTIPPMSAATDPWHLDNTDAELPINEERVIPDGV
NRDSAIIGGIIAVVLFTILCTLVFLIRYMFRHKGTYHTNEAKGGREQAGESADTAIIGTD
NQKTIDESKKEWFI
Download sequence
Identical sequences G3ND15
ENSGACP00000003215 ENSGACP00000003215 69293.ENSGACP00000003215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]