SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003234 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003234
Domain Number 1 Region: 499-775
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.27e-77
Family Eukaryotic proteases 0.00039
Further Details:      
 
Domain Number 2 Region: 172-277
Classification Level Classification E-value
Superfamily SRCR-like 1.31e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 3 Region: 401-500
Classification Level Classification E-value
Superfamily SRCR-like 4.58e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.000095
Further Details:      
 
Domain Number 4 Region: 280-383
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00022
Further Details:      
 
Domain Number 5 Region: 64-167
Classification Level Classification E-value
Superfamily SRCR-like 8.5e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00034
Further Details:      
 
Domain Number 6 Region: 1-66
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000104
Family Kringle modules 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003234   Gene: ENSGACG00000002479   Transcript: ENSGACT00000003245
Sequence length 777
Comment pep:novel group:BROADS1:groupVI:734075:746734:-1 gene:ENSGACG00000002479 transcript:ENSGACT00000003245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSHTDSGSACMKWTEFPDYMRQYAGRGLGDHSFCRNPDREANPWCFIRQSSGAIGWAYCD
CHQGAVRLAGGSSGNNGRVEVYLNGQWGAICDTHWTDRDASVICGQLGLGQIGTALQHSY
FGPGSVFHYERLGCRGNENSLLECRSRKFVTNDCNHGNEAGVVCAEPEGTGIPLRLVGGL
DDFEGRVELYRDGKWGTICDDRWDDTDAEVVCRQLGLGGVAKAWKWAHFGQGVGPIFLDG
VQCSGNELSLEECPHNIWEQHNCDHIEDAGVSCNPYTADGAVRLMGGDSHWGGRVEIYHH
GEWGTVCDDNWTELNAQVVCRQLGFRGRSKVAADGVYEEGRGRILLDEVQCRGTEAGLLA
CSHSEVGQHDCSHSEDVGVLCERGGDTNDMTGLLTPSGPLVRLVAGESRKEGRVEVFING
QWGSVCDDDWSDVNAAVVCRQLGFTGVAKARSVAYFGEGQGPIHLDNVRCSGAETSLGQC
PALGQDRHDCRHSEDAGVICDYTLDRVGDAALATQTCGVRLNNQRRRRRRIIGGDKSLSR
GEWPWQVSLWLRSQSKGSHPLCGASLINHCWVVTAAHCFKRFGRDPSRYLLRLGDHHTEE
QDDFERTLSPKRIVVHGKYHSQGWEYDIALLQLKGTEGSCVAFNPHTSAVCLPEPGNRWE
ERPAACVITGWGVTDSEYSRTLLQAWVPLLPARRCKRRYNERFTSRMLCAGSLSERHRVD
SCQGDSGGPLVCQGQGGRWVLTGVISWGHGCGDPAFPGVYTRVSRFLRWIDKTINKP
Download sequence
Identical sequences G3ND34
69293.ENSGACP00000003234 ENSGACP00000003234 ENSGACP00000003234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]