SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003381 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003381
Domain Number 1 Region: 373-481
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-26
Family SH2 domain 0.00000139
Further Details:      
 
Domain Number 2 Region: 485-526
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000115
Family SOCS box-like 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003381   Gene: ENSGACG00000002585   Transcript: ENSGACT00000003392
Sequence length 540
Comment pep:novel group:BROADS1:groupVI:904634:906326:1 gene:ENSGACG00000002585 transcript:ENSGACT00000003392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKVGNMWNNLKSKCQTLFHNGSGPSESRAEADGVHCVVDLGLGGSSGDAQASRASSPSR
SLLPVPMAPVGRRHHNCVSDVPQIVEITIDKDTEDVRGGSGGTPMARRDSYSRHAPWGGK
KKHSFSTKTQSSLEAERRPGRLRGAGNRRDRRYGVGSIQEMCDSVSGGRSLNARSLRQRL
SDTVGLCLPLPARRRSRSSKNPVASKRKIHLTELMLETCPFPPGSDLANKWHLIKQHTAP
VSPHSSTALLDAFDPAHPSPEDEEERLRERRRLSIEEGVDPPPNAQIHTLEASVPGSSLY
KLGPKLGPGTGEASGEGRASGSSDCDSEEDTTTLCLQARRPKQRHASGDVQLSRQQPGPW
KVHTQIDYIHCLVPDLLQITALPCYWGVMDRYEAEALLDGRPEGTFLLRDSAQEDYLFSV
SFRRYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSACMFFEPLLTAPLH
RTFPFGLQHLARAAICRWTTYDGIGSLPLPPALQDFLKEYHYKQKVRVRWLEREPPLKVK
Download sequence
Identical sequences G3NDI1
69293.ENSGACP00000003381 ENSGACP00000003381 ENSGACP00000003381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]