SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003494 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003494
Domain Number 1 Region: 4-457
Classification Level Classification E-value
Superfamily Sema domain 7.85e-136
Family Sema domain 0.00000013
Further Details:      
 
Domain Number 2 Region: 811-864
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 2.88e-16
Family TSP-1 type 1 repeat 0.00038
Further Details:      
 
Domain Number 3 Region: 755-806
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000051
Family TSP-1 type 1 repeat 0.00041
Further Details:      
 
Domain Number 4 Region: 563-613
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000562
Family TSP-1 type 1 repeat 0.00037
Further Details:      
 
Domain Number 5 Region: 453-503
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000139
Family Plexin repeat 0.0034
Further Details:      
 
Domain Number 6 Region: 617-669
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000275
Family TSP-1 type 1 repeat 0.00068
Further Details:      
 
Domain Number 7 Region: 506-560
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000111
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 8 Region: 867-911
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000116
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003494   Gene: ENSGACG00000002670   Transcript: ENSGACT00000003506
Sequence length 1044
Comment pep:novel group:BROADS1:groupXXI:6065576:6128487:-1 gene:ENSGACG00000002670 transcript:ENSGACT00000003506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVMLLAEMEPWIFRFKAEGTVDYSQLTFDPGQNELIVGARNHLFRLNLEDLTLIQEAEWH
CDEFTKGACFSRGKSEEECQNYIRVLLVNGNRLFTCGTNAFTPICTNRTLTNLTEIHDQI
SGMARCPYNPLHNSTALITSSGELYAATAMDFSGRDPAIYRSLGGLPPLRTAQYNSKWLN
AEPNFVSSYDISNFTYFFFRENAVEHDCGRTVFSRAGRVCKNDIGGRFLLEDTWTTFMKA
RLNCSRPGEIPFNYNELQGTFYLPELELLYGIFTTNVNSIAASAVCAFNLSAISQVFNGP
FKYQENSRSAWLPYPNPNPDFQCGTIDSGSYVNLTERNLQDAQKFLLMHEVVQPVVPVPY
FMEDNVRFTHVAVDVVQGKDVLFHIIYLATADYGTIRKVLSPLNQSTGSCLLEEIELFPP
RKRQPIRSLLILHSRSELYVGVRDQVIKIPLKRCRYHKSREACVGARDPYCGWDLLLKKC
TTLEESVRMSQWEQSITKCPIRNVTVDGGFGAWSGWSTCSHSDGGSAGGSCLCRTRACDS
PAPQCGGEHCYGVSVEVANCSRNGAWTPWTSWSPCSTSCGIGFQVRQRSCSNPTPRHGGR
VCVGQNREERYCNEHLPCPPHVYWSAWSAWERCTAPCGGGVQSRRRTCENGNDCPGCGQE
YQSCNTLPCPDLKKTTPWTPWTPVNISDNGGHYEQRFRYTCKARIPDPGLLEVGRQRIEM
RYCSSDGSTGCSTDGEGLSGGEVLRLGRISGHAMNGGWSSWSSWSQCSRDCSRGIRSRKR
TCSNPEPKYGGQTCLGPAQEYQECNVTPCPVDGSWSCWSSWSKCSVTCGGGHYMRTRTCS
NPPPAYGGDICLGLHTEEALCNTQSCPESWSSWSAWSHCDSNGAQMRVRHCDVLFPTGNQ
CSGNNSENRPCSPDSNFIEEVSIARSSQEEKLCGDFNLLHMIAVGLGSSILGCLVTLLVY
SYCQRFQRQSHEATVIHPISAAPLNTSITNHINKLDKYDSVEAIKAFNKNNLILEERNKY
FNPQLAGKTYTNAYFTDLKTYDDY
Download sequence
Identical sequences G3NDU4
ENSGACP00000003494 69293.ENSGACP00000003494 ENSGACP00000003494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]