SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003645 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003645
Domain Number 1 Region: 77-124
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000157
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000003645
Domain Number - Region: 38-78
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0012
Family Somatomedin B domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003645   Gene: ENSGACG00000002788   Transcript: ENSGACT00000003657
Sequence length 268
Comment pep:novel group:BROADS1:groupXXI:6671169:6674187:1 gene:ENSGACG00000002788 transcript:ENSGACT00000003657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSPVAFTCLLVALSTLGGNHSVSAGCSGRCCRGRDLSCLTTGWRMDRTHGTCYCDEGCA
RTRDCCFDYFTECPAQDCAVSGWSYWSGCAAACQASVRVRVRHVEQRPSNSGEPCPSLEQ
RSGCMEYRDRGGVRCVLNSGPAFITSMEFGKLDSQVLISHERPRDPASTPLRFCVEFTLE
TRTPHCTVENRPHTHWMRYIAEGFKVCVACEPPAMHNSGSCQGDGLESEKEALLHWQAVG
NHQCSGTWKKIRRTQRCTCPPQHSFVFI
Download sequence
Identical sequences G3NE94
69293.ENSGACP00000003645 ENSGACP00000003645 ENSGACP00000003645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]