SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003674 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003674
Domain Number 1 Region: 2-287
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-64
Family Protein kinases, catalytic subunit 0.0000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003674   Gene: ENSGACG00000002804   Transcript: ENSGACT00000003686
Sequence length 373
Comment pep:novel group:BROADS1:groupVI:1459804:1479124:-1 gene:ENSGACG00000002804 transcript:ENSGACT00000003686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYAMKYMNKQQCIERDEVRNVFRELEILQEIEHVFLVNLWYSFQDEEDMFMVVDLLLGGD
LRYHLQQSVQFSEDAVKLYLCEMTLALDYLQNQHIIHRDVKPDNILLDEQGHAHLTDFNI
ATIIKDGERATALAGTKPYMAPEIFQSFVSGGTGYAFEVDWWSLGVTIFEVLRGWRPYDI
HASNSVESLIQLFSTVSVQYSPAWPKALVSLLRKLLTVNPEHRFSGLSDMQASPYLADVN
WDAVCEKKLEAGFVPNKGRLHCDPTFELEEMILESRPLHKKKKRLAKNRSRDNSKDSQSE
NDYLQECLEVVQQEFMIFNREKFKRRQEEGQSEAGGDDATDEGEAEAGATDEDAESSSKL
SMCGSVCSSPASC
Download sequence
Identical sequences G3NEC3
69293.ENSGACP00000003674 ENSGACP00000003674 ENSGACP00000003674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]