SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003712 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003712
Domain Number 1 Region: 20-116,161-274,309-415
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.57e-36
Family LacY-like proton/sugar symporter 0.045
Further Details:      
 
Domain Number 2 Region: 442-492
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000128
Family Ovomucoid domain III-like 0.007
Further Details:      
 
Domain Number 3 Region: 540-659
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00000249
Family LacY-like proton/sugar symporter 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003712   Gene: ENSGACG00000002831   Transcript: ENSGACT00000003724
Sequence length 696
Comment pep:novel group:BROADS1:groupXXI:6981572:7001006:1 gene:ENSGACG00000002831 transcript:ENSGACT00000003724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRLIRVPARRYARFVLRDSRCFLFCMCYLTFIQSLMVSGYLSSVITTIEKRYSLRSSESG
LLVSCFDIGSLLVVVFISYFGGRGQRPRWLAVGGVVIAVGAALFSLPHFISPPYQIQEMN
ASMGNEGLCQSGNGSGREPGAAAACPRDQEGNEHGLYVTLFICAQILVGMGSTPIYTLGP
TYLDDNVKKENASLYLAVMYVMGALGPAAGYLLGGVLIGFYVDPKTVVNIDQSDPRFVGN
WWSGFLLCSVAMLLVIFPMFAFPKKLPPRHKKRKKKKMGSPGDVSSDDEVMKEKSSGKDE
NVSSSIGFGKDIKDLPKAALRILSNKTFLFVSLSYTAECAIVTAFITFIPKFIESQFGIP
ASNASIYTGVIIVPSAGVGIVLGGYIIKKLKLGARESAKLAMICSGVSLLCFSTLFIVGC
ESINLGGINIPYTTGPTLTMTHRNLTGSCNVNCGCRIHEYAPVCGSDGITYFNPCLAGCS
TGGNDSTGMRNYTDCGCVQSRQVITPSSGGQVNQLQLVIVKTYLNENGYAVSGKCDRTCN
TLIPFLIFLFIVTLITACAQPSAIIVTLRSVNEQERPFALGMQFVLLRTLAYIPTPIYFG
AVIDTTCMLWQQDCGVHGSCWEYDVTSFRFVYFGLAASLKFVGFIFIFLTWYSIKHKEDR
EDRWRQRLPPLGTVSELICHAGGHKSHARTRSCPVF
Download sequence
Identical sequences G3NEF6
ENSGACP00000003712 ENSGACP00000003707 69293.ENSGACP00000003707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]