SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003798 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003798
Domain Number 1 Region: 516-771
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.12e-50
Family Eukaryotic proteases 0.0025
Further Details:      
 
Domain Number 2 Region: 174-278
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.000095
Further Details:      
 
Domain Number 3 Region: 282-383
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00016
Further Details:      
 
Domain Number 4 Region: 65-166
Classification Level Classification E-value
Superfamily SRCR-like 4.58e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00041
Further Details:      
 
Domain Number 5 Region: 403-500
Classification Level Classification E-value
Superfamily SRCR-like 1.11e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00019
Further Details:      
 
Domain Number 6 Region: 1-67
Classification Level Classification E-value
Superfamily Kringle-like 1.21e-16
Family Kringle modules 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003798   Gene: ENSGACG00000002901   Transcript: ENSGACT00000003811
Sequence length 773
Comment pep:novel group:BROADS1:groupV:2128180:2135488:-1 gene:ENSGACG00000002901 transcript:ENSGACT00000003811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSQTDSGAPCLKWTEFPDYVMQYPGRGLGDHSYCRNPDRESNPWCFFRQNSGAIGWAYCD
CHQGAARLVGSSTSGSGRVEVYLNGQWGAVCDSHWSDRDASVICRQLGLGDIGAALRQPQ
FGSGSGLFHYERLGCRGDENTLSRCQSRTFVTGDCSHGNEAAVVCAAPEGSGPPLRLVGG
EEDFEGRVEVFHAGRWGSVCDDQWDDRDAEVVCRQLGFGGVAKAWSWAHFGQGSGPILLD
AVKCTGNELFLEQCSHGDWEQHNCDHMEDAGVSCSPFTDGVVRLVGGDSPWEGRVEVLHN
GDWGTVCDDRWSQQHAEVVCRQLGYRGHAEVVSDGTFGEGVGLILLDDVHCEGTETSLLD
CPHGIWGRTDCSHSEDVGVRCRRRPSQETNEVPVIAPSTGPLVRLVGGSSRKEGRVEVYL
HGDWGSICDSGWNDLNAAVVCRQLGHGGGAVAAGGFGQGKGPIHLDQVRCTGKEEFLGEC
PSLGQSIRGCRRRVDAGLRCDVAPRQPAVPAGHQEPSCGLRKLVEEESKRRSQGEENMLS
TTWPWQVSVWLQSQGEAGGPVCSGTLIGPCWALTSAYCVSRFGSDPSKYVVRVGARTLIP
ERLVVHRKFKGQSGGHDLALLKLPSTKGHCLTFDPDTNAACLPAADAASAGTTPSSCVVV
VTAGWTGPVYASLNSVLASWVPLMSSWQCKKRYGDSFSSHGTLCAGSPPDTSLLRDDRCD
GNSGGGLVCQGEMGRWVLTGVVAGGYGCAGPSSPSLYTRVSRFRGWIEEVINT
Download sequence
Identical sequences G3NEP7
ENSGACP00000003798 69293.ENSGACP00000003798 ENSGACP00000003798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]