SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003891 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003891
Domain Number 1 Region: 41-138
Classification Level Classification E-value
Superfamily SH2 domain 1.04e-23
Family SH2 domain 0.00022
Further Details:      
 
Domain Number 2 Region: 177-223
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000366
Family SOCS box-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003891   Gene: ENSGACG00000002975   Transcript: ENSGACT00000003905
Sequence length 225
Comment pep:novel group:BROADS1:groupV:2198433:2199203:-1 gene:ENSGACG00000002975 transcript:ENSGACT00000003905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VASSGRNPAAMSSVTPPEGRVQGSNRTLHHYKPFSSHEHYQQVMRALRKLQESGFYWGAV
GGREASARLRSEPPGTFLIRDSSDHHHFFTLSIQTSRGPKNLRIHSEGGGFFLQPDPQNT
QEPRQFDCVLKLVAHYMSKGPDGGRGREAPCGGNSREAEKSGCSAYLIHTSGEKIPLELR
RPLSSSLSSLQHMCRRALNNQEGSGGAEQLPHRLKDFLEEYDATI
Download sequence
Identical sequences G3NEZ0
ENSGACP00000003891 ENSGACP00000003891 69293.ENSGACP00000003891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]