SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004185 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004185
Domain Number 1 Region: 347-403
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000405
Family TSP-1 type 1 repeat 0.00041
Further Details:      
 
Domain Number 2 Region: 461-516
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000109
Family TSP-1 type 1 repeat 0.00033
Further Details:      
 
Domain Number 3 Region: 409-457
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000128
Family TSP-1 type 1 repeat 0.00068
Further Details:      
 
Domain Number 4 Region: 298-343
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000379
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 5 Region: 211-258
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000249
Family TSP-1 type 1 repeat 0.00095
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000004185
Domain Number - Region: 529-569
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00314
Family Hormone receptor domain 0.0044
Further Details:      
 
Domain Number - Region: 895-1157
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0833
Family Rhodopsin-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004185   Gene: ENSGACG00000003192   Transcript: ENSGACT00000004199
Sequence length 1528
Comment pep:novel group:BROADS1:groupX:4364784:4380750:1 gene:ENSGACG00000003192 transcript:ENSGACT00000004199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPASATCATLEQSRFFGVFSSTSTLHSTPCSWTLQNPDPRRYTVYMKITKPTDSCVPRQI
KTFQFDSFIETSRTYLGMESFDEVVKLCDASTTVTYLESTKQFLQIRKVAARNGVEMLEG
QNDVNEFKAEFLVVGKRNPSMPACQMLCQWLEKCLSSSTHDYPCGIMNTPCQCWEVPKRK
PGSCYKGGVYVEKCLPVPRDNGRDAEIIIKGWAGWGRWSVCSQECDGGVQVRSRACQPED
DVCEGTVEEGRACNPQPCIVSGKERNRSQGLRAIVGLKRDNADNSNYGVVATQTADSKTD
EWSPWSTCSITCGEGWQSRTRICATSSFTTQCTGALRENRPCNNTAVCPVDGAWDEWTPW
SLCSSTCGRGYRDRTRICKQPQNGGEPCRGPTRQTKFCNIAVCPGESMDGSWNEWSTWSP
CTASCSNGTMQRIRECNGPSYGGSECHGSWKESATCFLKDCPVDGRWHAWSSWASCSKTC
GGGLQQRQRVCEGPFFSGEPCPGEKGEQRRCNEKRCPEPHEICPEQNIGDVVWKKTAAGD
MAAVACPADASGVILRRCTLDAVGLASWESPTHTNCVSKNYDNIQMLSREYKSKAQMGQS
VDGVAEVISRLRFSSDEGAKYSGDLLAVMEILKNTTEQFKGTRLRLSNADVENYVQTISN
LLKEEHRDKWEEAQLMGAHIKEFLRLVEDFVSMIGMQMSGFQDIYEVTENLVLSIHKRPT
STNSNFTFPVKGWRGMLDWVRTSEEKISVSRDALSIDQAGFLLFADGNDAFVTGIVLYRN
LASILSLQSNTTLLNSKVVTVIVNPTPTLLSTPVEIEFPHLHNGTTNETCLSWDDSETPS
LCSSSLLGSWSARSCRAVPVHSFRTKCVCDSISTFAILARVNFDSIMDKSLLPSVTLIVG
CGVSSLTLLLLIIIYVSVWKYIRSERSVILINFCLSIICSNALILIGQTQARNKVVCTLV
AALLHFFFLSSFCWVLTEAWQSYMAVTGRLRNRIIRKRFLCLGWGLPALVVAVSVGFTKA
KGYGTVNYCWLSLEGGLLYSFVGPAAAVVLVNMVIGILVFNKLVSKDGITDVKLKERAGA
SLWSSCVVLPLLALTWMSAVLAITDRRSALFQILFAVFDSLEGFIIVMVHCILRREVQEA
VKCRVVDRKDDGSGNSGSSHHNGHSQIMSDSEKDRDSSRQDLINTISPPCHVASLFFNTL
SPSLLKGMKSPFEDKMPPPQLPLPMGSNFHTLPSNPSKSHMQAVPEYSSHTLTLKREKSR
LAGGVDPSCGKPVYVCEGELFKQLDADLARAQVEGSLCSDGSSYVLMPNTTSTLRSKPKD
EPTKYNISVEQLPQARLMHLSGPFAEPQAAFAMKSMPHDQVSVSYSERDSPIQNIHNMSS
ESHITHSSLENTFESMNSMMSKSETISTLSMSSLERQKSRYAELDFEKIMHTKKRHQNMF
QDLNRKLHHAEKDRESPASDSKQDKQQGPLDRPWEGVRGMQQSPPAWVRKDLEPLAASPL
ELHSVEWEKAGTTIPLVGQDIIDLQTEV
Download sequence
Identical sequences G3NFT0
ENSGACP00000004185 ENSGACP00000004185 69293.ENSGACP00000004185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]