SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004224 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004224
Domain Number 1 Region: 10-98
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000461
Family V set domains (antibody variable domain-like) 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004224   Gene: ENSGACG00000003230   Transcript: ENSGACT00000004238
Sequence length 197
Comment pep:novel group:BROADS1:groupXX:601999:603331:1 gene:ENSGACG00000003230 transcript:ENSGACT00000004238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRLEADRPFLRVQVGHTAELECCYRNSNNPVKWSWIKRAANGSLSEAPESTPVASSRSCG
TLTLELVQLKDSGFYQCSLKSNDCVVMSHGTYLQVYKPMEKIIQLSESTKNKILTAEGVL
LLLCVIVPSVNLLCQSRRLHELEKKKAMKEEENIYQGLNLDECWSAYDQIQRCEANGPYE
DVGNLREEEEEIQLEKP
Download sequence
Identical sequences G3NFW9
ENSGACP00000004224 69293.ENSGACP00000004224 ENSGACP00000004224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]