SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004389 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004389
Domain Number 1 Region: 561-617
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000288
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 2 Region: 670-725
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000068
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 620-670
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000262
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 4 Region: 506-558
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000115
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 5 Region: 760-813
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000968
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 444-490
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000327
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004389   Gene: ENSGACG00000003348   Transcript: ENSGACT00000004403
Sequence length 813
Comment pep:novel group:BROADS1:groupXIX:3466834:3532018:1 gene:ENSGACG00000003348 transcript:ENSGACT00000004403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYLHVMLLHCYFASSFLCTAVAFVEEPVGGRSDGYCGRILRAQTQGTRKEGHHEFRIRVE
GDPESYQPGSTYRVVLLATSPSYFRGFTLIALKEGREGTVDDDYIGQFQNIDEEDTQFMT
NCAPAVTESTPRRRTRIQVFWTAPPTGSGCVIMKASIVQKRVIYFQDEGSLTIRLCEKER
VFGEATGAPAMECCACGTAKYRLTFYGNWSEKVHPKDYPRRANHWSALIGASHSRGYVLW
EYGGYASEGVRQVAEFGSPIKMEEEIRQKGDEVLTVIKTKAQWPAWQPLNLLYQTKPRRA
APSAEFSVDRTRHLMSFLTMLGPSPDWNVGLSGEDLCTKDCGWVQRLETDLIPWDAGTDN
GVTYESPNKPTIPQEKIRPLTSLDHPQSPFYDPEGGAITPIAKLVVERIARKGEQCNVVP
DTIDDIVADIGQEDKEEDDTPETCIYSGWSPWSACSSATCEKGRRMRQRMLKAQLDLSVP
CPHTQDFQPCMGPGCSIEATLRWTEPSTCMMSEWISWSACSVSCGMGMRSRERYVKQYPE
DGSLCQLQTEETEKCVVNDECSPSSCVVTEWAEWDPCSVTCGLGMRRRERMVKMPPIDGS
MCKTEVAEVEKCMMPECHSLPCMLSPWSDWSDCSVTCGRGLRTRQRMLKSDPAGCSEELE
QTEKCMLPECPADCMVSEWSEWSECNKSCGKGHTIRTRMVKLEPQFGGSACPETIQRKKC
KIRKCRTKGGSRGAVGGAGGGQRRRRGKQGRDSVAEEQPGCRMQPWTAWTDCTKACSGGI
QERFMVAKKRAKGAMAVGCKDRKEVRACNVHPC
Download sequence
Identical sequences G3NGD3
ENSGACP00000004389 ENSGACP00000004389 69293.ENSGACP00000004389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]