SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004440 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004440
Domain Number 1 Region: 6-209
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.83e-48
Family Ankyrin repeat 0.00015
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000004440
Domain Number - Region: 223-263
Classification Level Classification E-value
Superfamily SOCS box-like 0.000209
Family SOCS box-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004440   Gene: ENSGACG00000003395   Transcript: ENSGACT00000004454
Sequence length 264
Comment pep:novel group:BROADS1:groupXVI:7711922:7714172:-1 gene:ENSGACG00000003395 transcript:ENSGACT00000004454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSDFWSDRTPLHEAAYQGRLLHLRSLIVQGFHVDTLTLDRVSPLHEACLGGHYACAKFLL
ENGANVETVSTDGATPLFNSCSSGSAACVRLMLQHRASVLSPCRLASPIHEAAKKGHNEC
VELLLSYGAPIDMEFPVVGTPLYSACMARAAACAGLLLQSGADVGIGCGQDTPLHAAVQA
GGADVVDLLLDFGADECCRNSEGKTPLDLSPPNSAVRNALQKKGPRSLCQLGRLCIRRSL
GRSRLHRATGLFLPHSMKDFLLYK
Download sequence
Identical sequences G3NGI4
ENSGACP00000004440 ENSGACP00000004440 69293.ENSGACP00000004440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]