SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004511 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004511
Domain Number 1 Region: 25-100
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000565
Family Growth factor receptor domain 0.004
Further Details:      
 
Domain Number 2 Region: 94-160
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000136
Family VWC domain 0.058
Further Details:      
 
Domain Number 3 Region: 216-261
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000262
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004511   Gene: ENSGACG00000003446   Transcript: ENSGACT00000004525
Sequence length 370
Comment pep:novel group:BROADS1:groupXIII:365127:367968:1 gene:ENSGACG00000003446 transcript:ENSGACT00000004525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQIMSTLFVFCSAAVMADNECPAECSCPPSPQPCPPGVSWVTDHCGCCKVCAKQFNEDC
SATKPCDHIKGLRCHLGAGGDPERGLCRAEAQGLPCEFSGRVYQHREDFQPNCQHQCTCM
DGVVGCMPLCPRQVPLPYWRCQRPRLARPEGGCCEEWVCDDSNHMPRRSLGTQPLPGGSR
AEKDENEKLYITNKGFSLSFTAEMASFPVSTMLHKSSCFAQTTEWTECSTTCGMGISSRV
SNDHPDCRLLRETRLCQIRQCELQPPAASKKGKKCQRTFRPQEPVRITFAGCSTPQRYRP
RTCGTCSDGRCCTPSVSRTVTLRFHCPDGEGFYRKVMWIQRCSCNRSCHVHSGPSSPSVS
LHNDIHTFRR
Download sequence
Identical sequences G3NGQ5
69293.ENSGACP00000004511 ENSGACP00000004511 ENSGACP00000004511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]