SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004604 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004604
Domain Number 1 Region: 469-678
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.76e-27
Family Laminin G-like module 0.026
Further Details:      
 
Domain Number 2 Region: 693-892
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-19
Family Laminin G-like module 0.024
Further Details:      
 
Domain Number 3 Region: 913-1105
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.13e-18
Family Laminin G-like module 0.0069
Further Details:      
 
Domain Number 4 Region: 138-269
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000557
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 5 Region: 304-346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000714
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 6 Region: 1282-1323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000103
Family EGF-type module 0.0039
Further Details:      
 
Domain Number 7 Region: 265-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000607
Family EGF-type module 0.0034
Further Details:      
 
Domain Number 8 Region: 1127-1239
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000204
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 9 Region: 27-70
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000154
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 10 Region: 397-434
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000791
Family EGF-type module 0.013
Further Details:      
 
Domain Number 11 Region: 342-405
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000954
Family EGF-type module 0.01
Further Details:      
 
Domain Number 12 Region: 1247-1282
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000111
Family EGF-type module 0.017
Further Details:      
 
Domain Number 13 Region: 112-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00003
Family EGF-type module 0.013
Further Details:      
 
Domain Number 14 Region: 72-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000331
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000004604
Domain Number - Region: 894-945
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0063
Family EGF-type module 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004604   Gene: ENSGACG00000003512   Transcript: ENSGACT00000004618
Sequence length 1393
Comment pep:novel group:BROADS1:groupXIII:448241:467821:1 gene:ENSGACG00000003512 transcript:ENSGACT00000004618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTKFVSLLILFYISFLSLECVKGLLCTVAADSCLSSPCYNSATCLDHLGEYVCICPPGP
VRYIGKNCDELYDACIEAPCTNCTSTPGTNEFTCQCPDGFTGLNCTQDVDNNVTTCSETS
CQNAGTCMDVPDIGHGCQCAAGYQGRNCEENIDECQSEPCQNGAICKDRVNAYQCFCVPG
FQGYHCDLDINECASRPCQNNGTCQDEVDHYRCDCAPGFKGINCQVEIDECEVHPCQNGA
TCRDHVATYTCECMAGFQSQNCEVNIDECASIPCLNQGQCIDLVNSYECDCEGTGFVGDH
CEEDIPECASDPCQHGATCLEKINEYKCLCWPGYEGENCQLDVDECAEQPCENGGECFQR
SDTRNYRMLPEFADANFSYKEAAGFICRCLPGFTGVHCEVDINECDSNPCKNGAICEDAA
NSYKCHCPEPEPGQEPWGGQDCDFSLVGCRQHQCQHEAGCVPLLTDDGEHTYTCLCPPGW
AGERCNTSTIFSFNSKGYVHLQLPFSKNRTNQETKDQASYKLHMHLRFKSTLKDMVLYYR
GTKDRFISLELVGGSLRARVKSETVLQVIYHGLVNDGEWYTATVTMDERLVLVVKGPGCE
ENCLVKNESYNHLIFLQPSSFQQLYVGGAPQEYLAKTSSGRGFIGCMEDLQVDHKLLLPQ
DLIREENHGLELGCLKKDWCKDDPCMQRGQCVDMWVHPSCECNRPYYGESCEKGYPSWTF
GHENTSTSYVGFNITQTHGDNFTISFLMRSFKHNGLLLQLHREGKPYLTVYLKEGTVAIY
SPHTTLLSEARSVTDGNNNLVTLKVQYGHVVFPKAGNHRALGNVSIEAGDVAYVGGLPAG
NSMNAWGGNFKGCLQDIRLDHSHLTTGDPLGGVKVYQASTEETVLPGCHSDDTCKDQPCL
NGGQCQVTWNDFQCNCSMRYDGRLCETRLWCMDNPCPDAVRCVDLQDGYECLTESIFQDN
ALQYVANSSLLSPITNVTMDIRTRDENGILLRAVSGAKVFCLGLLNSSLLVKLDGGASQE
LLAFTSDRTIADGAWHRIEVAMVDPTQLASRWRLTVDRQRVGGSFRIGGNLNFLNDTKIW
LAEKYTGCLGEVRVGGVYLPLVNVPEAPQVSQFSRLGGYEPMQGCQGPPICDSQPCLNQG
VCQDQFNEFNCTCSAGWEGELCEREVNECSSGPCVHGTCKDLLAHYQCDCEPGYTGKDCR
DEVDNCLEFSCVNGGTCTLNVGVHTCSCPTGYVGKRCHRWRFPPAACDANTDCLNGGVCI
GSDSGGNCTCKHGYTGPRCETEIDECESSPCLNGATCLDRLNHFQCVCVLGFSGTLCERI
KEEHKERVPWLVVTIPLTTLCVLLAILVVFCLVITARKKRQSEGTYSPSSQEVAGARLEM
GSVLKVPPEERLI
Download sequence
Identical sequences G3NGZ7
69293.ENSGACP00000004604 ENSGACP00000004604 ENSGACP00000004604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]