SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004701 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004701
Domain Number 1 Region: 276-431
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-43
Family SPRY domain 0.00014
Further Details:      
 
Domain Number 2 Region: 11-81
Classification Level Classification E-value
Superfamily RING/U-box 3.93e-19
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 3 Region: 86-144
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.65e-16
Family B-box zinc-binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004701   Gene: ENSGACG00000003587   Transcript: ENSGACT00000004715
Sequence length 454
Comment pep:novel group:BROADS1:groupXVII:894902:896627:1 gene:ENSGACG00000003587 transcript:ENSGACT00000004715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CFTKPMASRSGEDLSCSVCQDIFKDPVVLSCSHSFCRDCLKRWWAEKLTQDCPVCNRRSS
RSDPPASLVIKNLCESFILERDQRGPEKVCSLHSEKLKLFCLDHLQPVCVVCRDSKTHNN
HRFQPINEAAEDLKKEIQKYLKPFKKKLKLFVKVKGNCDQTAAHMKVQARHTEVKIKDQF
KKLHRFLEEEEEARLSALREEEKQKSQMMEEKMEPLSREIAALSDTVRATEEQLRAEDIS
FLNHYKAAVERVRQPPLLEDHQLLSGALIDQAKHLGNPVVLDPNTAHPELVLSEDLTSVS
RGERQKLPDNPERFNSFIAVLGSEGFNSGIYSWDVEVGDNACWFVGVAEESVERKGSVWS
GMWRIGFSMGSYKALYPSAQPINLSLREKLQRIRVHLDWAKGLFFYDAATKKHIFTFSHK
FTQKLFPYISSSNKLPRMCVCVFLSTSPCVMSPK
Download sequence
Identical sequences G3NH93
ENSGACP00000004701 69293.ENSGACP00000004701 ENSGACP00000004701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]