SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004772 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004772
Domain Number 1 Region: 311-494
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-56
Family SPRY domain 0.0000248
Further Details:      
 
Domain Number 2 Region: 22-82
Classification Level Classification E-value
Superfamily RING/U-box 5.2e-19
Family RING finger domain, C3HC4 0.0057
Further Details:      
 
Domain Number 3 Region: 90-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000214
Family B-box zinc-binding domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004772   Gene: ENSGACG00000003633   Transcript: ENSGACT00000004786
Sequence length 494
Comment pep:novel group:BROADS1:groupXVI:8209590:8211269:-1 gene:ENSGACG00000003633 transcript:ENSGACT00000004786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQPAFLLNVLLDMAAAGTLLTKEQLLCPICLDLFNQPVSTPCGHNFCRDCIQRYWQSANL
SQCPMCKQKFYRRPELKVNTFICTFKKHHLINPTMNMQDRVCKKHAKLLDLFCNTDQTCV
CQVCIKRDHSAHRTVSVVDESRDRRAQIQRINAEVEEMIKCRLEKISEINQTVELSRGNT
DREIEESMQVFNNLLHFVQRGQAEVVEAIGAKQRKIQGEARGLIVELEQEINELRRRNAE
LEELSRAEDDLFLIRSFPGSSTPPATRDWSTTCVESAVYVGTVRRAVRRVACQLEETVKA
EVKRLCETEFQRAKQCAVDVTLDPDTAHPKLVLSENRKQVFHCDVAQSFPDNPMRFYPGV
SVLGKEGFSSGRLYCEVQVKGKTEWDIGVGLQSISRKGGTIVNPETGYWALGMRKDSSYW
ALSSTPIRVPLVGKPQRVGVYVDLDWGQVSFYDTDSASHIYSFTGYSFNDRLFLYLNPRR
NHGGVNSAPLIIVP
Download sequence
Identical sequences G3NHG4
ENSGACP00000004772 69293.ENSGACP00000004772 ENSGACP00000004772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]