SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004861 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004861
Domain Number 1 Region: 882-1054
Classification Level Classification E-value
Superfamily Fibronectin type III 3.33e-18
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 2 Region: 1072-1154
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000552
Family Fibronectin type III 0.0033
Further Details:      
 
Domain Number 3 Region: 274-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000226
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 4 Region: 764-807
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000714
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 5 Region: 553-591
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000357
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 6 Region: 725-762
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000357
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 7 Region: 349-387
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000432
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 8 Region: 592-630
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000466
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 9 Region: 311-355
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000636
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 10 Region: 670-726
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000639
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 11 Region: 516-550
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000857
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 12 Region: 1281-1317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000508
Family EGF-type module 0.012
Further Details:      
 
Domain Number 13 Region: 802-844
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000067
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 14 Region: 234-279
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000389
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 15 Region: 842-879
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000456
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 16 Region: 438-469
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000647
Family EGF-type module 0.026
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000004861
Domain Number - Region: 395-433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0559
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 470-497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0897
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004861   Gene: ENSGACG00000003698   Transcript: ENSGACT00000004875
Sequence length 1380
Comment pep:novel group:BROADS1:groupVIII:1762207:1782279:1 gene:ENSGACG00000003698 transcript:ENSGACT00000004875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDAETIAQDDGGSRLVEISVAFPFFGDKHTGLYVNNNGLVSFLREVSQFTPVAFPIAGD
RRVVAPFWADVDNRRAGRVFYRESREPSILSRASGDVNAYFSEFPRFNATWVLISTWHQV
TFFGGNSLTPVNTFQAVLITDGDLSFTIFQYNNITWTTGMHVSSGGNPAGLGGIAAQAGF
NAGDGKRYFNIPGSRTADVVNVEGTTNVGYPGKWVFRIDDANVEVGSCNDSASVCPHLRP
CLNGGQCIDDCVTGNPSFSCSCLAGFTGRRCQIDVNECASRPCQNGGTCGDQINGFLCHC
PPGYTGSQCETDVDECKDKPCLNNALCVQGTGGFTCVCEPGYTGVLCETDINECEPQPCL
GGGECVDQVANFTCVCPAAFTGELCQTGDFTLTAACEEDGDCREHRVCGDAGSGASNCTC
APGFYGDQCESEITKECLCQNGGVCVDINGTCECPSGYTGLYCQFEVTQTPCSNSRTCPD
GGPCLEYGGTYLCTCQTSAAELDHKDFYPYVQPRSACDSSPCLNGGYCYERDGGYTCECK
YGYRGKHCEKVRLNTCASGPCRNGGSCKEEAGSYRCVCPYRFTGKHCEVGKPDPCASSPC
RNGGTCFHYIGKYKCECTEAFSGRHCEISRTSLQAVAVCSWMSSGVRELASQCGRADVNN
VFVFLSELGCGPPPQVKNAEVQFSSTTTGSMAVYICHSGFRSVPRATQSICGIQGDWSQP
PVCEEVNECLSQPCLNGGTCRNQVGSHQCECADGFSGSRCQTADIKTCLSEPCEHGGTCE
DRPGSYLCHCSQGFKGQNCEMEQDGCESGPCLNGGVCRGYRRNYLCSCKGGFFGDQCQML
ENPCVLQPCGNRGLCRSDKRGNYNCFCRVGHTGKDCEKDLLPPSGLHVLRVEENEVELRW
DEPEASHSPVSGFLVTYAPLGRSDPKSDLLERRQSSHVMRGLVPGMLYNISTFSIKRNTD
SNDNSQPATALIRTRPPPAEQLQAVNVSSSQVWLSWLVQAAHHAAVSRVHVSLTPADGGE
ARTAVLNASATEHTFSSLVPGQMYTVDVMTQSGIRPDEFPSTSHSAGPLQFWTRPLPPQN
LSLSHVTTNSALISWSRHPRNVPDGFVVNVTRGLNTRSRFLPNGRLGSYTLRELTPGQNY
YVALTAVRSTGQEQIHSFPQHLAFATLPMGARSGRRERPSGTGPGPQVVRTLPPSQPQHR
GGTTETENSDELPSQRCRYTELIDRRGKITAKFTHTPRKAVRHRTRPEPATRLEKIEETT
NKISLALEIQEGLRTKPALPQDCRGLPCHNGGTCVSQGDSFVCDCAAEFKGRQCELLCQR
VPHPCTRLYSETKSVPVWEDGVCHYLYKRTYKVQQDVCYREICEATPPKKSQVRRTNRQQ
Download sequence
Identical sequences G3NHQ1
69293.ENSGACP00000004861 ENSGACP00000004861 ENSGACP00000004861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]